BLASTX nr result
ID: Zingiber24_contig00043211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00043211 (1254 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319129.1| putative leucine-rich repeat transmembrane p... 74 1e-10 ref|XP_002325367.2| putative leucine-rich repeat transmembrane p... 72 6e-10 gb|EMJ08428.1| hypothetical protein PRUPE_ppa000976mg [Prunus pe... 69 5e-09 ref|XP_006349975.1| PREDICTED: probable leucine-rich repeat rece... 66 3e-08 ref|XP_006340921.1| PREDICTED: probable leucine-rich repeat rece... 66 3e-08 ref|XP_002522030.1| Leucine-rich repeat receptor protein kinase ... 66 3e-08 gb|EOY10795.1| Leucine-rich repeat protein kinase family protein... 65 4e-08 ref|XP_004253173.1| PREDICTED: probable leucine-rich repeat rece... 64 2e-07 ref|XP_002448135.1| hypothetical protein SORBIDRAFT_06g021910 [S... 63 3e-07 gb|EOY05413.1| Leucine-rich repeat receptor-like protein kinase ... 62 4e-07 tpg|DAA37041.1| TPA: putative leucine-rich repeat receptor prote... 62 5e-07 gb|EXB93124.1| putative leucine-rich repeat receptor-like protei... 61 8e-07 ref|XP_002283031.2| PREDICTED: probable leucine-rich repeat rece... 61 1e-06 emb|CBI33340.3| unnamed protein product [Vitis vinifera] 61 1e-06 emb|CAN79986.1| hypothetical protein VITISV_039668 [Vitis vinifera] 61 1e-06 ref|XP_006653582.1| PREDICTED: probable leucine-rich repeat rece... 60 2e-06 gb|ESW17228.1| hypothetical protein PHAVU_007G221800g [Phaseolus... 60 2e-06 gb|EOY05411.1| Leucine-rich repeat receptor-like protein kinase ... 60 2e-06 ref|XP_004150344.1| PREDICTED: probable leucine-rich repeat rece... 60 2e-06 ref|XP_006420529.1| hypothetical protein CICLE_v10004196mg [Citr... 59 3e-06 >ref|XP_002319129.1| putative leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|222857505|gb|EEE95052.1| putative leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 1106 Score = 73.9 bits (180), Expect = 1e-10 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = +3 Query: 1125 GINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 G+N EGQYLL++KS+IGD+ NHL +W+P+D T CGWKGVNC+ Sbjct: 23 GLNAEGQYLLDIKSRIGDAYNHLSNWNPNDSTPCGWKGVNCT 64 >ref|XP_002325367.2| putative leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|550316750|gb|EEE99748.2| putative leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 1107 Score = 71.6 bits (174), Expect = 6e-10 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = +3 Query: 1125 GINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 G+N EGQYLL++KS+IGD+ NHL +W+P+D CGWKGVNC+ Sbjct: 25 GLNAEGQYLLDIKSRIGDTYNHLSNWNPNDSIPCGWKGVNCT 66 >gb|EMJ08428.1| hypothetical protein PRUPE_ppa000976mg [Prunus persica] Length = 944 Score = 68.6 bits (166), Expect = 5e-09 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = +3 Query: 1119 TEGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 +EG+N EGQYLLE+KS++ D +HL SW+ +D T CGW+GVNCS Sbjct: 5 SEGLNDEGQYLLEIKSRLVDRFDHLSSWNSNDFTPCGWRGVNCS 48 >ref|XP_006349975.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At2g33170-like [Solanum tuberosum] Length = 1097 Score = 66.2 bits (160), Expect = 3e-08 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +3 Query: 1122 EGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 EG+N EG YLLELK + D N+L++W+PSD T C WKGVNC+ Sbjct: 30 EGLNAEGMYLLELKKNLNDEFNNLENWNPSDETPCRWKGVNCT 72 >ref|XP_006340921.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At2g33170-like [Solanum tuberosum] Length = 1109 Score = 66.2 bits (160), Expect = 3e-08 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +3 Query: 1122 EGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 EG+N EG YLLELK DS NHL +W+P+D T CGW GVNC+ Sbjct: 33 EGLNQEGMYLLELKKNFQDSFNHLGNWNPNDETPCGWVGVNCT 75 >ref|XP_002522030.1| Leucine-rich repeat receptor protein kinase EXS precursor, putative [Ricinus communis] gi|223538834|gb|EEF40434.1| Leucine-rich repeat receptor protein kinase EXS precursor, putative [Ricinus communis] Length = 1123 Score = 65.9 bits (159), Expect = 3e-08 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +3 Query: 1125 GINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 G+N +GQ+LL++KS++ D+ NHL W+P+D T CGWKGVNC+ Sbjct: 27 GLNADGQFLLDIKSRLVDNSNHLTDWNPNDSTPCGWKGVNCT 68 >gb|EOY10795.1| Leucine-rich repeat protein kinase family protein [Theobroma cacao] Length = 1122 Score = 65.5 bits (158), Expect = 4e-08 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +3 Query: 1125 GINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 G+N EGQYLL++KSK+ D N+L +W+P+D T CGW+GVNC+ Sbjct: 50 GLNSEGQYLLDIKSKLVDKFNYLGNWNPNDPTPCGWEGVNCT 91 >ref|XP_004253173.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930-like [Solanum lycopersicum] Length = 1073 Score = 63.5 bits (153), Expect = 2e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 1122 EGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 EG+N EG YLLELK + D N+L +W+PSD T C WKGVNC+ Sbjct: 6 EGLNAEGMYLLELKKSLKDESNNLGNWNPSDETPCRWKGVNCT 48 >ref|XP_002448135.1| hypothetical protein SORBIDRAFT_06g021910 [Sorghum bicolor] gi|241939318|gb|EES12463.1| hypothetical protein SORBIDRAFT_06g021910 [Sorghum bicolor] Length = 982 Score = 62.8 bits (151), Expect = 3e-07 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +3 Query: 1119 TEGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 ++G+N EG LL LKS++ D+L+HLD WD D+T C W+GVNCS Sbjct: 22 SQGLNHEGWLLLALKSQMNDTLHHLDDWDARDVTPCNWRGVNCS 65 >gb|EOY05413.1| Leucine-rich repeat receptor-like protein kinase family protein [Theobroma cacao] Length = 1106 Score = 62.4 bits (150), Expect = 4e-07 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +3 Query: 1116 ITEGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 I +G+N EGQ LLELK+ + D N+L +W PSD T CGW GVNC+ Sbjct: 28 IADGLNSEGQLLLELKNSLHDEYNYLGNWKPSDETPCGWIGVNCT 72 >tpg|DAA37041.1| TPA: putative leucine-rich repeat receptor protein kinase family protein [Zea mays] Length = 1097 Score = 62.0 bits (149), Expect = 5e-07 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = +3 Query: 1119 TEGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 ++G+N EG LL LKS++ D+L+HLD+WD DLT C WKGV+CS Sbjct: 20 SQGLNHEGWLLLALKSQMNDTLHHLDNWDARDLTPCIWKGVSCS 63 >gb|EXB93124.1| putative leucine-rich repeat receptor-like protein kinase [Morus notabilis] Length = 1103 Score = 61.2 bits (147), Expect = 8e-07 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = +3 Query: 1119 TEGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNC 1247 +EG+N EGQYLLE+K + D N+L +W+ SD T CGW+GV C Sbjct: 26 SEGLNTEGQYLLEIKRSLVDVFNYLGNWNSSDSTPCGWRGVRC 68 >ref|XP_002283031.2| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At2g33170-like [Vitis vinifera] Length = 1105 Score = 60.8 bits (146), Expect = 1e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +3 Query: 1119 TEGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 +EG+N EG LLELK + D NHL +W+PSD T CGW GVNC+ Sbjct: 29 SEGLNSEGLLLLELKHGLYDQFNHLYNWNPSDQTPCGWIGVNCT 72 >emb|CBI33340.3| unnamed protein product [Vitis vinifera] Length = 1032 Score = 60.8 bits (146), Expect = 1e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +3 Query: 1119 TEGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 +EG+N EG LLELK + D NHL +W+PSD T CGW GVNC+ Sbjct: 29 SEGLNSEGLLLLELKHGLYDQFNHLYNWNPSDQTPCGWIGVNCT 72 >emb|CAN79986.1| hypothetical protein VITISV_039668 [Vitis vinifera] Length = 1066 Score = 60.8 bits (146), Expect = 1e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +3 Query: 1119 TEGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 +EG+N EG LLELK + D NHL +W+PSD T CGW GVNC+ Sbjct: 33 SEGLNSEGLLLLELKHGLYDQFNHLYNWNPSDQTPCGWIGVNCT 76 >ref|XP_006653582.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930-like [Oryza brachyantha] Length = 1102 Score = 60.1 bits (144), Expect = 2e-06 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = +3 Query: 1119 TEGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 ++G+N EG LL LK ++ D+ +HLD W P D + CGWKGVNCS Sbjct: 26 SQGLNHEGWLLLTLKKQMVDTFHHLDDWSPGDPSPCGWKGVNCS 69 >gb|ESW17228.1| hypothetical protein PHAVU_007G221800g [Phaseolus vulgaris] Length = 1111 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +3 Query: 1119 TEGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 +EG+N EGQ LLELK+ + D N L++W +D T CGWKGVNC+ Sbjct: 29 SEGLNTEGQILLELKNGLHDKSNVLENWKRTDETPCGWKGVNCT 72 >gb|EOY05411.1| Leucine-rich repeat receptor-like protein kinase family protein, putative [Theobroma cacao] Length = 686 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +3 Query: 1116 ITEGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 ++E +N EG YLLELK+ I D NHL +W P+D T C W GVNC+ Sbjct: 225 VSETLNSEGTYLLELKNSILDEFNHLGNWKPTDETPCRWIGVNCT 269 >ref|XP_004150344.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930-like [Cucumis sativus] gi|449515008|ref|XP_004164542.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930-like [Cucumis sativus] Length = 1103 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = +3 Query: 1116 ITEGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 I+ G+N EG +LLELK+ I D L +WD SD T CGW GVNC+ Sbjct: 28 ISHGLNQEGHFLLELKNNISDPFGSLRNWDSSDETPCGWTGVNCT 72 >ref|XP_006420529.1| hypothetical protein CICLE_v10004196mg [Citrus clementina] gi|557522402|gb|ESR33769.1| hypothetical protein CICLE_v10004196mg [Citrus clementina] Length = 1132 Score = 59.3 bits (142), Expect = 3e-06 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = +3 Query: 1119 TEGINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSCGWKGVNCS 1250 TEG+N EG YLLELK+ + D N L SW +D T C W GVNC+ Sbjct: 56 TEGLNSEGHYLLELKNSLHDEFNFLKSWKSTDQTPCSWIGVNCT 99