BLASTX nr result
ID: Zingiber24_contig00043095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00043095 (403 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX96734.1| SWAP/surp domain-containing protein / D111/G-patc... 55 9e-06 >gb|EOX96734.1| SWAP/surp domain-containing protein / D111/G-patch domain-containing protein isoform 1 [Theobroma cacao] gi|508704839|gb|EOX96735.1| SWAP/surp domain-containing protein / D111/G-patch domain-containing protein isoform 1 [Theobroma cacao] gi|508704840|gb|EOX96736.1| SWAP/surp domain-containing protein / D111/G-patch domain-containing protein isoform 1 [Theobroma cacao] Length = 439 Score = 55.1 bits (131), Expect = 9e-06 Identities = 33/73 (45%), Positives = 43/73 (58%), Gaps = 3/73 (4%) Frame = -2 Query: 210 LFVNDGYFMERIKRLQQ---EKGVVAAATDQPKXXXXXXXSVALKPTTIVSKRPLEVKFN 40 LFVNDG FMER K+LQQ EK AAA ++ K S A KP ++K ++ K N Sbjct: 9 LFVNDGSFMERFKQLQQQKDEKDKAAAALEESKPPKIVKGSSAPKPAIALNKISMDFKHN 68 Query: 39 DIKKGTPQTSGGK 1 D +K + +SGGK Sbjct: 69 DARKTSQTSSGGK 81