BLASTX nr result
ID: Zingiber24_contig00043024
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00043024 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006366725.1| PREDICTED: cytochrome c oxidase subunit 2-li... 58 1e-06 >ref|XP_006366725.1| PREDICTED: cytochrome c oxidase subunit 2-like, partial [Solanum tuberosum] Length = 164 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/49 (63%), Positives = 34/49 (69%) Frame = -1 Query: 147 RRIVLFIRVGVESFLRGNLQVKFGGRRASTXXXXXXXXXXXXXXSLTFD 1 R+IV F+RVGVESFLRGNLQV+FGGRRAST SLTFD Sbjct: 1 RKIVFFLRVGVESFLRGNLQVQFGGRRASTLPYEYSDYNSSDEQSLTFD 49