BLASTX nr result
ID: Zingiber24_contig00042798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00042798 (542 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594025.1| Serine/threonine protein phosphatase 6 regul... 59 6e-07 ref|XP_004486074.1| PREDICTED: uncharacterized protein LOC101501... 57 4e-06 ref|XP_002526408.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 >ref|XP_003594025.1| Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit A [Medicago truncatula] gi|355483073|gb|AES64276.1| Serine/threonine protein phosphatase 6 regulatory ankyrin repeat subunit A [Medicago truncatula] Length = 693 Score = 59.3 bits (142), Expect = 6e-07 Identities = 32/77 (41%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Frame = -2 Query: 232 DSVLHVVI-ASRKINLAVAIIGLPDDINRNILCHRNYFGDTPLHIAAEIGNSEVAKALVA 56 D+VLH+ I S+ I + + + D+ RNIL +N G+TPLH+AAE+GN E+ + Sbjct: 41 DTVLHIAIYVSQTIFVTTLLDNISQDMCRNILRMQNSKGNTPLHVAAELGNVEICNNIAR 100 Query: 55 GDGSLAHKKNKKGETPL 5 D L +N +GETPL Sbjct: 101 RDPILISYRNFEGETPL 117 >ref|XP_004486074.1| PREDICTED: uncharacterized protein LOC101501840 [Cicer arietinum] Length = 693 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/77 (37%), Positives = 49/77 (63%), Gaps = 1/77 (1%) Frame = -2 Query: 232 DSVLHV-VIASRKINLAVAIIGLPDDINRNILCHRNYFGDTPLHIAAEIGNSEVAKALVA 56 D++LH+ V S+ + + + +++RNIL +N G+TPLH+AAE+GN ++ +V Sbjct: 41 DTLLHISVYVSQTCFVTTLLDNISQNMSRNILRLQNSKGNTPLHVAAELGNVDICNNIVK 100 Query: 55 GDGSLAHKKNKKGETPL 5 D +L +N +GETPL Sbjct: 101 RDHTLISCRNLEGETPL 117 >ref|XP_002526408.1| conserved hypothetical protein [Ricinus communis] gi|223534270|gb|EEF35984.1| conserved hypothetical protein [Ricinus communis] Length = 291 Score = 56.2 bits (134), Expect = 5e-06 Identities = 33/87 (37%), Positives = 47/87 (54%), Gaps = 4/87 (4%) Frame = -2 Query: 250 PLNLMNDSVLHVVIASRKINLAVAIIGLPDDINRNI----LCHRNYFGDTPLHIAAEIGN 83 PL + D+ LH+ I S L ++I + + RN+ N +G+T LH AA GN Sbjct: 72 PLTVNKDTALHIAIYSGSTRLIESMIEITKQVARNLTRSPFLIDNEYGNTALHEAAASGN 131 Query: 82 SEVAKALVAGDGSLAHKKNKKGETPLH 2 AK L+A + SL KNK GETP++ Sbjct: 132 LRAAKQLLACERSLLEIKNKLGETPIY 158