BLASTX nr result
ID: Zingiber24_contig00042645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00042645 (314 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002874835.1| predicted protein [Arabidopsis lyrata subsp.... 55 7e-06 >ref|XP_002874835.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297320672|gb|EFH51094.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 300 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 100 KRQRLMERASPLPSFKVRKEKLGDRITALQQLV 2 KRQRL E SPLPSFKVRKEKLGDRITALQQLV Sbjct: 160 KRQRL-ETLSPLPSFKVRKEKLGDRITALQQLV 191