BLASTX nr result
ID: Zingiber24_contig00042539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00042539 (403 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK79028.1| cytochrome P450 CYP707A67 [Bupleurum chinense] 60 3e-07 ref|XP_006283694.1| hypothetical protein CARUB_v10004758mg [Caps... 57 3e-06 ref|NP_567581.1| abscisic acid 8'-hydroxylase 1 [Arabidopsis tha... 56 4e-06 ref|NP_974574.1| abscisic acid 8'-hydroxylase 1 [Arabidopsis tha... 56 4e-06 ref|XP_002869993.1| CYP707A1 [Arabidopsis lyrata subsp. lyrata] ... 56 4e-06 emb|CAA16713.1| cytochrome P450 [Arabidopsis thaliana] gi|726871... 56 4e-06 ref|XP_006878626.1| hypothetical protein AMTR_s00011p00261570 [A... 56 6e-06 >gb|AFK79028.1| cytochrome P450 CYP707A67 [Bupleurum chinense] Length = 464 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 315 SGYRKLTLPPGSMGWPYVGETFQLYSNDP 401 SG+RKL LPPG+MGWPY+GETFQLYS DP Sbjct: 28 SGHRKLPLPPGTMGWPYIGETFQLYSQDP 56 >ref|XP_006283694.1| hypothetical protein CARUB_v10004758mg [Capsella rubella] gi|482552399|gb|EOA16592.1| hypothetical protein CARUB_v10004758mg [Capsella rubella] Length = 463 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 312 RSGYRKLTLPPGSMGWPYVGETFQLYSNDP 401 R G KL LPPG+MGWPYVGETFQLYS DP Sbjct: 24 RRGSSKLPLPPGTMGWPYVGETFQLYSQDP 53 >ref|NP_567581.1| abscisic acid 8'-hydroxylase 1 [Arabidopsis thaliana] gi|75306306|sp|Q949P1.1|ABAH1_ARATH RecName: Full=Abscisic acid 8'-hydroxylase 1; Short=ABA 8'-hydroxylase 1; AltName: Full=Cytochrome P450 707A1 gi|15293093|gb|AAK93657.1| putative cytochrome P450 protein [Arabidopsis thaliana] gi|20259299|gb|AAM14385.1| putative cytochrome P450 protein [Arabidopsis thaliana] gi|46401564|dbj|BAD16629.1| cytochrome P450 monooxygenase [Arabidopsis thaliana] gi|332658762|gb|AEE84162.1| abscisic acid 8'-hydroxylase 1 [Arabidopsis thaliana] Length = 467 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 312 RSGYRKLTLPPGSMGWPYVGETFQLYSNDP 401 R G KL LPPG+MGWPYVGETFQLYS DP Sbjct: 28 RFGSSKLPLPPGTMGWPYVGETFQLYSQDP 57 >ref|NP_974574.1| abscisic acid 8'-hydroxylase 1 [Arabidopsis thaliana] gi|332658763|gb|AEE84163.1| abscisic acid 8'-hydroxylase 1 [Arabidopsis thaliana] Length = 484 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 312 RSGYRKLTLPPGSMGWPYVGETFQLYSNDP 401 R G KL LPPG+MGWPYVGETFQLYS DP Sbjct: 28 RFGSSKLPLPPGTMGWPYVGETFQLYSQDP 57 >ref|XP_002869993.1| CYP707A1 [Arabidopsis lyrata subsp. lyrata] gi|297315829|gb|EFH46252.1| CYP707A1 [Arabidopsis lyrata subsp. lyrata] Length = 484 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 312 RSGYRKLTLPPGSMGWPYVGETFQLYSNDP 401 R G KL LPPG+MGWPYVGETFQLYS DP Sbjct: 28 RLGSSKLPLPPGTMGWPYVGETFQLYSQDP 57 >emb|CAA16713.1| cytochrome P450 [Arabidopsis thaliana] gi|7268718|emb|CAB78925.1| cytochrome P450 [Arabidopsis thaliana] Length = 457 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 312 RSGYRKLTLPPGSMGWPYVGETFQLYSNDP 401 R G KL LPPG+MGWPYVGETFQLYS DP Sbjct: 28 RFGSSKLPLPPGTMGWPYVGETFQLYSQDP 57 >ref|XP_006878626.1| hypothetical protein AMTR_s00011p00261570 [Amborella trichopoda] gi|548831969|gb|ERM94771.1| hypothetical protein AMTR_s00011p00261570 [Amborella trichopoda] Length = 461 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/35 (71%), Positives = 29/35 (82%), Gaps = 2/35 (5%) Frame = +3 Query: 303 LAG--RSGYRKLTLPPGSMGWPYVGETFQLYSNDP 401 LAG R G R+L LPPGS+GWPY+GETFQLYS +P Sbjct: 21 LAGHLRRGRRRLPLPPGSLGWPYIGETFQLYSQNP 55