BLASTX nr result
ID: Zingiber24_contig00042479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00042479 (242 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006472016.1| PREDICTED: pentatricopeptide repeat-containi... 90 3e-16 ref|XP_006433326.1| hypothetical protein CICLE_v10000527mg [Citr... 90 3e-16 gb|EMT00923.1| hypothetical protein F775_21545 [Aegilops tauschii] 90 3e-16 ref|XP_004960291.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 gb|AFW57619.1| putative pentatricopeptide repeat family protein ... 88 1e-15 ref|NP_001169748.1| uncharacterized protein LOC100383629 [Zea ma... 88 1e-15 gb|EOY11338.1| Tetratricopeptide repeat-like superfamily protein... 88 1e-15 ref|XP_003566566.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 ref|XP_006577247.1| PREDICTED: pentatricopeptide repeat-containi... 86 4e-15 ref|XP_002280725.1| PREDICTED: pentatricopeptide repeat-containi... 86 7e-15 emb|CAN74829.1| hypothetical protein VITISV_002140 [Vitis vinifera] 86 7e-15 ref|XP_002440589.1| hypothetical protein SORBIDRAFT_09g003570 [S... 85 1e-14 ref|XP_002512380.1| pentatricopeptide repeat-containing protein,... 84 3e-14 gb|EMJ08360.1| hypothetical protein PRUPE_ppa023606mg [Prunus pe... 83 3e-14 ref|XP_004494620.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 gb|EXC40551.1| hypothetical protein L484_000424 [Morus notabilis] 81 2e-13 ref|XP_006361845.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_004230191.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 ref|XP_002319538.2| hypothetical protein POPTR_0013s02200g [Popu... 79 6e-13 ref|XP_003626292.1| Pentatricopeptide repeat-containing protein ... 79 6e-13 >ref|XP_006472016.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340-like [Citrus sinensis] Length = 899 Score = 90.1 bits (222), Expect = 3e-16 Identities = 47/81 (58%), Positives = 57/81 (70%), Gaps = 1/81 (1%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFA-EEANSLT 65 +YF+ GS S RKVF MR RNV+TWTA++SGL QN L E+ L +F MR NSLT Sbjct: 200 SYFKCGSSSSGRKVFGEMRVRNVITWTAVISGLVQNQLYEEGLKLFVKMRLGLINPNSLT 259 Query: 64 YTSVLLACSGLRALPVGRQIH 2 Y S ++ACSGL+AL GRQIH Sbjct: 260 YLSSVIACSGLQALCEGRQIH 280 >ref|XP_006433326.1| hypothetical protein CICLE_v10000527mg [Citrus clementina] gi|557535448|gb|ESR46566.1| hypothetical protein CICLE_v10000527mg [Citrus clementina] Length = 659 Score = 90.1 bits (222), Expect = 3e-16 Identities = 47/81 (58%), Positives = 57/81 (70%), Gaps = 1/81 (1%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFA-EEANSLT 65 +YF+ GS S RKVF MR RNV+TWTA++SGL QN L E+ L +F MR NSLT Sbjct: 200 SYFKCGSSSSGRKVFGEMRVRNVITWTAVISGLVQNQLYEEGLKLFVKMRLGLINPNSLT 259 Query: 64 YTSVLLACSGLRALPVGRQIH 2 Y S ++ACSGL+AL GRQIH Sbjct: 260 YLSSVIACSGLQALCEGRQIH 280 >gb|EMT00923.1| hypothetical protein F775_21545 [Aegilops tauschii] Length = 613 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/80 (53%), Positives = 56/80 (70%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAEEANSLTY 62 AYF GSP A++ F GM RNV+TWTAM+SG+A+ L EDS+ +F MR +AN+ TY Sbjct: 166 AYFECGSPDSAKRAFQGMTGRNVITWTAMISGMARAELYEDSILLFRQMRRTVDANNATY 225 Query: 61 TSVLLACSGLRALPVGRQIH 2 +S LLAC+G A G+QIH Sbjct: 226 SSSLLACAGSLAAKEGKQIH 245 >ref|XP_004960291.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340-like [Setaria italica] Length = 614 Score = 88.2 bits (217), Expect = 1e-15 Identities = 45/80 (56%), Positives = 56/80 (70%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAEEANSLTY 62 AYF GSP A +VF M RNV+TWTAMVSG+A+ L +SL++F MR A +ANS TY Sbjct: 171 AYFECGSPGSAERVFGAMVERNVITWTAMVSGMARAELDRESLSLFRQMRRAVDANSATY 230 Query: 61 TSVLLACSGLRALPVGRQIH 2 +S LLAC+G A G+QIH Sbjct: 231 SSSLLACAGSLAAREGQQIH 250 >gb|AFW57619.1| putative pentatricopeptide repeat family protein [Zea mays] Length = 611 Score = 88.2 bits (217), Expect = 1e-15 Identities = 44/80 (55%), Positives = 56/80 (70%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAEEANSLTY 62 AYF SP A +VFDGM RNV+TWTAMVSG+A+ +SL++F MR A +AN +Y Sbjct: 170 AYFECSSPGSAERVFDGMADRNVITWTAMVSGMARAERYSESLSLFRQMRRAVDANRASY 229 Query: 61 TSVLLACSGLRALPVGRQIH 2 +S LLAC+G RA G+QIH Sbjct: 230 SSSLLACAGSRAAREGQQIH 249 >ref|NP_001169748.1| uncharacterized protein LOC100383629 [Zea mays] gi|224031397|gb|ACN34774.1| unknown [Zea mays] Length = 546 Score = 88.2 bits (217), Expect = 1e-15 Identities = 44/80 (55%), Positives = 56/80 (70%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAEEANSLTY 62 AYF SP A +VFDGM RNV+TWTAMVSG+A+ +SL++F MR A +AN +Y Sbjct: 105 AYFECSSPGSAERVFDGMADRNVITWTAMVSGMARAERYSESLSLFRQMRRAVDANRASY 164 Query: 61 TSVLLACSGLRALPVGRQIH 2 +S LLAC+G RA G+QIH Sbjct: 165 SSSLLACAGSRAAREGQQIH 184 >gb|EOY11338.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 762 Score = 87.8 bits (216), Expect = 1e-15 Identities = 47/81 (58%), Positives = 57/81 (70%), Gaps = 1/81 (1%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAEEA-NSLT 65 +Y + G S R+VFD M RNV+TWTAM+SGL QN L E+SL +F+ MR NSLT Sbjct: 202 SYSKCGCLSSGRQVFDEMFERNVITWTAMISGLVQNELYEESLELFNEMRLGSVCPNSLT 261 Query: 64 YTSVLLACSGLRALPVGRQIH 2 Y S L+ACSGL+AL GRQIH Sbjct: 262 YLSSLMACSGLQALNEGRQIH 282 >ref|XP_003566566.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340-like [Brachypodium distachyon] Length = 614 Score = 87.8 bits (216), Expect = 1e-15 Identities = 43/80 (53%), Positives = 55/80 (68%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAEEANSLTY 62 AYF SP A + F GM RNV+TWTAM+SG+A+ L +DS+ +F MR +ANS TY Sbjct: 167 AYFECESPGSAERAFHGMAERNVITWTAMISGMAREELYKDSIVLFQQMRRTVDANSATY 226 Query: 61 TSVLLACSGLRALPVGRQIH 2 +S LLAC+G AL G+QIH Sbjct: 227 SSSLLACAGSLALKEGQQIH 246 >ref|XP_006577247.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340-like [Glycine max] Length = 656 Score = 86.3 bits (212), Expect = 4e-15 Identities = 47/81 (58%), Positives = 56/81 (69%), Gaps = 1/81 (1%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAE-EANSLT 65 +YF+ G S R+VFD M RNVVTWTA++SGLAQN ED L +F MR NSLT Sbjct: 200 SYFKCGCFSQGRQVFDEMLERNVVTWTAVISGLAQNEFYEDGLRLFDQMRRGSVSPNSLT 259 Query: 64 YTSVLLACSGLRALPVGRQIH 2 Y S L+ACSGL+AL GR+IH Sbjct: 260 YLSALMACSGLQALLEGRKIH 280 >ref|XP_002280725.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340 [Vitis vinifera] Length = 656 Score = 85.5 bits (210), Expect = 7e-15 Identities = 45/81 (55%), Positives = 57/81 (70%), Gaps = 1/81 (1%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAE-EANSLT 65 +YFR G S R+VFD M +NVVTWTA++SGL+Q E+SL +F MR + NSLT Sbjct: 200 SYFRCGCCSSGRRVFDEMSEKNVVTWTAVISGLSQGQFYEESLKLFGKMRDGPVDPNSLT 259 Query: 64 YTSVLLACSGLRALPVGRQIH 2 Y S L+ACSGL+A+ GRQIH Sbjct: 260 YLSSLMACSGLQAIREGRQIH 280 >emb|CAN74829.1| hypothetical protein VITISV_002140 [Vitis vinifera] Length = 542 Score = 85.5 bits (210), Expect = 7e-15 Identities = 45/81 (55%), Positives = 57/81 (70%), Gaps = 1/81 (1%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAE-EANSLT 65 +YFR G S R+VFD M +NVVTWTA++SGL+Q E+SL +F MR + NSLT Sbjct: 86 SYFRCGCCSSGRRVFDEMSEKNVVTWTAVISGLSQGQFYEESLKLFGKMRDGPVDPNSLT 145 Query: 64 YTSVLLACSGLRALPVGRQIH 2 Y S L+ACSGL+A+ GRQIH Sbjct: 146 YLSSLMACSGLQAIREGRQIH 166 >ref|XP_002440589.1| hypothetical protein SORBIDRAFT_09g003570 [Sorghum bicolor] gi|241945874|gb|EES19019.1| hypothetical protein SORBIDRAFT_09g003570 [Sorghum bicolor] Length = 613 Score = 84.7 bits (208), Expect = 1e-14 Identities = 43/80 (53%), Positives = 54/80 (67%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAEEANSLTY 62 AYF SP A +VFD M RNVVTWTAMVSG+A+ +SL++F MR A +AN +Y Sbjct: 173 AYFECSSPGSAERVFDAMADRNVVTWTAMVSGMARAERYRESLSLFRQMRHAVDANRASY 232 Query: 61 TSVLLACSGLRALPVGRQIH 2 +S LLAC+G A G+QIH Sbjct: 233 SSSLLACAGSLAASEGQQIH 252 >ref|XP_002512380.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548341|gb|EEF49832.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 736 Score = 83.6 bits (205), Expect = 3e-14 Identities = 45/80 (56%), Positives = 55/80 (68%), Gaps = 1/80 (1%) Frame = -2 Query: 238 YFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFA-EEANSLTY 62 + R+G R+VFD M RNV+TWTA++SGL+QN + EDSL +F MR E N LTY Sbjct: 33 FLRNGDLDTGRQVFDEMLERNVITWTAIISGLSQNEMYEDSLGLFVQMRCGLIEPNFLTY 92 Query: 61 TSVLLACSGLRALPVGRQIH 2 S L ACSGL+AL GRQIH Sbjct: 93 LSSLTACSGLQALEKGRQIH 112 >gb|EMJ08360.1| hypothetical protein PRUPE_ppa023606mg [Prunus persica] Length = 646 Score = 83.2 bits (204), Expect = 3e-14 Identities = 45/81 (55%), Positives = 56/81 (69%), Gaps = 1/81 (1%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRF-AEEANSLT 65 +Y + GS R+VFD M RNV+TWTAM+SGLAQN +SL +F MR + NSLT Sbjct: 204 SYCKCGSFGSGRRVFDEMFERNVITWTAMISGLAQNEFYVESLELFLEMRSGVVDPNSLT 263 Query: 64 YTSVLLACSGLRALPVGRQIH 2 Y + L ACSGL+A+ VGRQIH Sbjct: 264 YLASLTACSGLQAISVGRQIH 284 >ref|XP_004494620.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340-like [Cicer arietinum] Length = 661 Score = 82.4 bits (202), Expect = 6e-14 Identities = 46/81 (56%), Positives = 55/81 (67%), Gaps = 1/81 (1%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAE-EANSLT 65 +YF+ G S RKVFD M RNVVTWTA++SGLAQN EDSL +F MR N LT Sbjct: 205 SYFKCGCFSQGRKVFDEMIERNVVTWTAVISGLAQNEFYEDSLRLFTRMRCGSVNPNVLT 264 Query: 64 YTSVLLACSGLRALPVGRQIH 2 Y S L+ACSG +AL G++IH Sbjct: 265 YLSSLMACSGSQALKDGQKIH 285 >gb|EXC40551.1| hypothetical protein L484_000424 [Morus notabilis] Length = 656 Score = 80.9 bits (198), Expect = 2e-13 Identities = 44/81 (54%), Positives = 55/81 (67%), Gaps = 1/81 (1%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAEEA-NSLT 65 +YF+ S R+VFD + RNV+TWTAM+SGL +N L ++SL F MR NSLT Sbjct: 200 SYFKCRCSSSGRRVFDELLERNVITWTAMISGLVRNELYKESLEFFVLMRSGTVCPNSLT 259 Query: 64 YTSVLLACSGLRALPVGRQIH 2 Y S L+ACSGL+AL GRQIH Sbjct: 260 YLSSLMACSGLQALSEGRQIH 280 >ref|XP_006361845.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340-like [Solanum tuberosum] Length = 667 Score = 80.9 bits (198), Expect = 2e-13 Identities = 43/81 (53%), Positives = 54/81 (66%), Gaps = 1/81 (1%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAEEA-NSLT 65 +YFR G R+VFD M RNV++WTA++SGLAQN E+SL + M+ A N LT Sbjct: 197 SYFRCGCADSGRQVFDEMAMRNVISWTAVISGLAQNEFCEESLDLLVKMQGAAVVPNYLT 256 Query: 64 YTSVLLACSGLRALPVGRQIH 2 Y S LLACSG++AL RQIH Sbjct: 257 YLSALLACSGMKALGEARQIH 277 >ref|XP_004230191.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340-like [Solanum lycopersicum] Length = 667 Score = 80.5 bits (197), Expect = 2e-13 Identities = 43/81 (53%), Positives = 54/81 (66%), Gaps = 1/81 (1%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRFAEEA-NSLT 65 +YFR G R+VFD M RNV++WTA++SGLAQN E+SL + M+ A N LT Sbjct: 197 SYFRCGCADSGRQVFDEMDMRNVISWTAVISGLAQNEFCEESLDLLVKMQNAAVVPNYLT 256 Query: 64 YTSVLLACSGLRALPVGRQIH 2 Y S LLACSG++AL RQIH Sbjct: 257 YLSALLACSGMKALGEARQIH 277 >ref|XP_002319538.2| hypothetical protein POPTR_0013s02200g [Populus trichocarpa] gi|550324744|gb|EEE95461.2| hypothetical protein POPTR_0013s02200g [Populus trichocarpa] Length = 670 Score = 79.0 bits (193), Expect = 6e-13 Identities = 44/81 (54%), Positives = 54/81 (66%), Gaps = 1/81 (1%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNM-RFAEEANSLT 65 +YF+ G S +VFD M RNV+TWTA++SGL Q+ L DSL +F M E NSLT Sbjct: 196 SYFKCGFSSSGMQVFDEMLERNVITWTAIISGLVQSELYRDSLRLFVEMTNGLVEPNSLT 255 Query: 64 YTSVLLACSGLRALPVGRQIH 2 Y S L+ACSGL+AL G QIH Sbjct: 256 YLSSLMACSGLQALREGCQIH 276 >ref|XP_003626292.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355501307|gb|AES82510.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 650 Score = 79.0 bits (193), Expect = 6e-13 Identities = 45/82 (54%), Positives = 55/82 (67%), Gaps = 2/82 (2%) Frame = -2 Query: 241 AYFRSGSPSCARKVFDGMRCRNVVTWTAMVSGLAQNLLPEDSLAMFHNMRF--AEEANSL 68 +YF+ S RKVFD M RNVVTWTA++SGLAQN EDSL +F MR + N L Sbjct: 193 SYFKCECFSQGRKVFDEMIERNVVTWTAVISGLAQNEFYEDSLRLFAQMRCCGSVSPNVL 252 Query: 67 TYTSVLLACSGLRALPVGRQIH 2 TY S L+ACSGL+ L G++IH Sbjct: 253 TYLSSLMACSGLQVLRDGQKIH 274