BLASTX nr result
ID: Zingiber24_contig00042399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00042399 (310 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_195056.2| putative disease resistance protein ADR1-like 1... 57 3e-06 emb|CAB38788.1| putative protein [Arabidopsis thaliana] gi|72702... 57 3e-06 >ref|NP_195056.2| putative disease resistance protein ADR1-like 1 [Arabidopsis thaliana] gi|79326231|ref|NP_001031781.1| putative disease resistance protein ADR1-like 1 [Arabidopsis thaliana] gi|357529538|sp|Q9SZA7.3|DRL29_ARATH RecName: Full=Probable disease resistance protein At4g33300 gi|222423391|dbj|BAH19667.1| AT4G33300 [Arabidopsis thaliana] gi|332660803|gb|AEE86203.1| putative disease resistance protein ADR1-like 1 [Arabidopsis thaliana] gi|332660804|gb|AEE86204.1| putative disease resistance protein ADR1-like 1 [Arabidopsis thaliana] Length = 816 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/47 (51%), Positives = 37/47 (78%) Frame = +3 Query: 3 LARKMERIDHWITRWLERQVPAHLLADVHHIRVDYTARLDRIERTLD 143 LARKME+++ I+ +L+ +V H+LADVHH+R D + RLDR++ +LD Sbjct: 96 LARKMEKLEKTISNFLKNEVFTHILADVHHLRADTSVRLDRVDMSLD 142 >emb|CAB38788.1| putative protein [Arabidopsis thaliana] gi|7270278|emb|CAB80047.1| putative protein [Arabidopsis thaliana] Length = 855 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/47 (51%), Positives = 37/47 (78%) Frame = +3 Query: 3 LARKMERIDHWITRWLERQVPAHLLADVHHIRVDYTARLDRIERTLD 143 LARKME+++ I+ +L+ +V H+LADVHH+R D + RLDR++ +LD Sbjct: 96 LARKMEKLEKTISNFLKNEVFTHILADVHHLRADTSVRLDRVDMSLD 142