BLASTX nr result
ID: Zingiber24_contig00042085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00042085 (300 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY09133.1| Heat shock protein DnaJ with tetratricopeptide re... 60 4e-07 gb|EOY09132.1| Heat shock protein DnaJ with tetratricopeptide re... 60 4e-07 gb|EOY09131.1| Heat shock protein DnaJ with tetratricopeptide re... 60 4e-07 >gb|EOY09133.1| Heat shock protein DnaJ with tetratricopeptide repeat, putative isoform 3 [Theobroma cacao] Length = 1293 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/96 (32%), Positives = 50/96 (52%) Frame = -3 Query: 289 EFRSSRTTDDMLKENLFSGPRKSAPFSGKKAESKASRMRKRNGKLNNLSPQHQTFAQTFP 110 +F++ + K NLF + F K +K +++K GKL S H+ ++ Sbjct: 619 DFKTPQWDPSSFKANLFPEVDRKLEFGEKSGLTKEKKLKKMRGKLKK-SCLHKHCSKQHH 677 Query: 109 FAEEAFESKYTDSANCYSPMDYTPYQENLVVDASSR 2 +E+ + DS+ CYSPMD++PYQEN D SS+ Sbjct: 678 VPKESTSQENQDSSQCYSPMDFSPYQENTAADQSSK 713 >gb|EOY09132.1| Heat shock protein DnaJ with tetratricopeptide repeat, putative isoform 2 [Theobroma cacao] Length = 1369 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/96 (32%), Positives = 50/96 (52%) Frame = -3 Query: 289 EFRSSRTTDDMLKENLFSGPRKSAPFSGKKAESKASRMRKRNGKLNNLSPQHQTFAQTFP 110 +F++ + K NLF + F K +K +++K GKL S H+ ++ Sbjct: 619 DFKTPQWDPSSFKANLFPEVDRKLEFGEKSGLTKEKKLKKMRGKLKK-SCLHKHCSKQHH 677 Query: 109 FAEEAFESKYTDSANCYSPMDYTPYQENLVVDASSR 2 +E+ + DS+ CYSPMD++PYQEN D SS+ Sbjct: 678 VPKESTSQENQDSSQCYSPMDFSPYQENTAADQSSK 713 >gb|EOY09131.1| Heat shock protein DnaJ with tetratricopeptide repeat, putative isoform 1 [Theobroma cacao] Length = 1291 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/96 (32%), Positives = 50/96 (52%) Frame = -3 Query: 289 EFRSSRTTDDMLKENLFSGPRKSAPFSGKKAESKASRMRKRNGKLNNLSPQHQTFAQTFP 110 +F++ + K NLF + F K +K +++K GKL S H+ ++ Sbjct: 422 DFKTPQWDPSSFKANLFPEVDRKLEFGEKSGLTKEKKLKKMRGKLKK-SCLHKHCSKQHH 480 Query: 109 FAEEAFESKYTDSANCYSPMDYTPYQENLVVDASSR 2 +E+ + DS+ CYSPMD++PYQEN D SS+ Sbjct: 481 VPKESTSQENQDSSQCYSPMDFSPYQENTAADQSSK 516