BLASTX nr result
ID: Zingiber24_contig00042055
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00042055 (923 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB97164.1| NADPH-dependent diflavin oxidoreductase 1 [Morus ... 58 6e-06 ref|XP_006297226.1| hypothetical protein CARUB_v10013233mg [Caps... 57 7e-06 >gb|EXB97164.1| NADPH-dependent diflavin oxidoreductase 1 [Morus notabilis] Length = 786 Score = 57.8 bits (138), Expect = 6e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +3 Query: 3 DVTSTLEEIIMEESGISKESAAKWLRLLEKAGRFFIEAWS 122 DV S EEII +ESG+ KESA +WLR LE+AG++ +EAWS Sbjct: 747 DVLSAFEEIISKESGLPKESAVRWLRALERAGKYHVEAWS 786 >ref|XP_006297226.1| hypothetical protein CARUB_v10013233mg [Capsella rubella] gi|482565935|gb|EOA30124.1| hypothetical protein CARUB_v10013233mg [Capsella rubella] Length = 621 Score = 57.4 bits (137), Expect = 7e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +3 Query: 3 DVTSTLEEIIMEESGISKESAAKWLRLLEKAGRFFIEAWS 122 DV S LEEI+ EE+G SKE A++WL+ LEKAGR+ +EAWS Sbjct: 582 DVMSALEEIVSEETGGSKEVASRWLKALEKAGRYNVEAWS 621