BLASTX nr result
ID: Zingiber24_contig00041914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00041914 (265 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW73630.1| putative RING zinc finger domain superfamily prot... 80 4e-13 dbj|BAD16922.1| zinc finger -like [Oryza sativa Japonica Group] ... 79 6e-13 ref|XP_002438034.1| hypothetical protein SORBIDRAFT_10g007000 [S... 79 6e-13 gb|EEC74065.1| hypothetical protein OsI_09075 [Oryza sativa Indi... 79 6e-13 gb|EAZ24742.1| hypothetical protein OsJ_08513 [Oryza sativa Japo... 79 6e-13 ref|XP_004964907.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 79 8e-13 ref|XP_004954037.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 78 1e-12 gb|AFW76696.1| putative RING zinc finger domain superfamily prot... 78 1e-12 gb|AFW64340.1| putative RING zinc finger domain superfamily prot... 77 2e-12 gb|AFW64339.1| putative RING zinc finger domain superfamily prot... 77 2e-12 ref|XP_002452884.1| hypothetical protein SORBIDRAFT_04g034270 [S... 77 3e-12 ref|XP_003573045.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 74 2e-11 ref|XP_006472751.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 73 5e-11 ref|XP_006434154.1| hypothetical protein CICLE_v10003221mg [Citr... 73 5e-11 ref|NP_001149547.1| RHC1A [Zea mays] gi|195627928|gb|ACG35794.1|... 73 5e-11 gb|EOY16234.1| RING/U-box superfamily protein, putative [Theobro... 72 1e-10 ref|XP_004499404.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 70 3e-10 ref|XP_003601068.1| RING finger protein [Medicago truncatula] gi... 70 3e-10 ref|XP_002513785.1| zinc finger protein, putative [Ricinus commu... 69 7e-10 dbj|BAD35703.1| zinc finger-like [Oryza sativa Japonica Group] 67 2e-09 >gb|AFW73630.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 321 Score = 79.7 bits (195), Expect = 4e-13 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 226 RTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLP 104 RTCR++WCYQC RA+R+I PS+D+ CPRC+GRFLHEIDLP Sbjct: 11 RTCRMYWCYQCGRALRIISYPSTDVFCPRCFGRFLHEIDLP 51 >dbj|BAD16922.1| zinc finger -like [Oryza sativa Japonica Group] gi|46806079|dbj|BAD17327.1| zinc finger -like [Oryza sativa Japonica Group] Length = 340 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -1 Query: 265 PSSMSLRHPSAAPRTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPR 95 P+ +RH RTCR++WCYQC RA+R+I PS+D+ CPRC+GRFLHEID P PR Sbjct: 6 PAQGGVRHH----RTCRMYWCYQCGRAIRIISYPSTDVFCPRCFGRFLHEID-PPPR 57 >ref|XP_002438034.1| hypothetical protein SORBIDRAFT_10g007000 [Sorghum bicolor] gi|241916257|gb|EER89401.1| hypothetical protein SORBIDRAFT_10g007000 [Sorghum bicolor] Length = 334 Score = 79.0 bits (193), Expect = 6e-13 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -1 Query: 226 RTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPRLVI 86 RT RL+WCY C RAVR + P+SD+ CPRC+GRFLHEIDLP PR V+ Sbjct: 14 RTWRLYWCYVCGRAVRAVSYPTSDVFCPRCFGRFLHEIDLPAPRPVV 60 >gb|EEC74065.1| hypothetical protein OsI_09075 [Oryza sativa Indica Group] Length = 327 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -1 Query: 265 PSSMSLRHPSAAPRTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPR 95 P+ +RH RTCR++WCYQC RA+R+I PS+D+ CPRC+GRFLHEID P PR Sbjct: 6 PAQGGVRHH----RTCRMYWCYQCGRAIRIISYPSTDVFCPRCFGRFLHEID-PPPR 57 >gb|EAZ24742.1| hypothetical protein OsJ_08513 [Oryza sativa Japonica Group] Length = 337 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -1 Query: 265 PSSMSLRHPSAAPRTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPR 95 P+ +RH RTCR++WCYQC RA+R+I PS+D+ CPRC+GRFLHEID P PR Sbjct: 6 PAQGGVRHH----RTCRMYWCYQCGRAIRIISYPSTDVFCPRCFGRFLHEID-PPPR 57 >ref|XP_004964907.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Setaria italica] Length = 310 Score = 78.6 bits (192), Expect = 8e-13 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -1 Query: 226 RTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPRLVI 86 RT RL+WCY C RAVR + P+SD+ CPRC+GRFLHEIDLP PR V+ Sbjct: 14 RTWRLYWCYVCGRAVRAVSYPTSDVFCPRCFGRFLHEIDLPAPRPVL 60 >ref|XP_004954037.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Setaria italica] Length = 311 Score = 78.2 bits (191), Expect = 1e-12 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 235 AAPRTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLP 104 A RTCR++WCYQC RA+R+I PS+D+ CPRC+GRFLHEID P Sbjct: 12 ARHRTCRMYWCYQCGRALRIISYPSTDVFCPRCFGRFLHEIDAP 55 >gb|AFW76696.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 340 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -1 Query: 226 RTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPRLVI 86 RT RL+WCY C RAVR I P+S++ CPRC+GRFLHEIDLP PR V+ Sbjct: 20 RTWRLYWCYVCGRAVRAISYPASEVFCPRCFGRFLHEIDLPAPRPVV 66 >gb|AFW64340.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 318 Score = 77.4 bits (189), Expect = 2e-12 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -1 Query: 235 AAPRTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPR 95 A RTCR +WCYQC RA+R+I PS+D+ CPRC+GRFLHE+D P R Sbjct: 9 ARHRTCRTYWCYQCGRALRIISCPSTDVFCPRCFGRFLHEVDPPTAR 55 >gb|AFW64339.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 323 Score = 77.4 bits (189), Expect = 2e-12 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -1 Query: 235 AAPRTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPR 95 A RTCR +WCYQC RA+R+I PS+D+ CPRC+GRFLHE+D P R Sbjct: 9 ARHRTCRTYWCYQCGRALRIISCPSTDVFCPRCFGRFLHEVDPPTAR 55 >ref|XP_002452884.1| hypothetical protein SORBIDRAFT_04g034270 [Sorghum bicolor] gi|241932715|gb|EES05860.1| hypothetical protein SORBIDRAFT_04g034270 [Sorghum bicolor] Length = 318 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/54 (62%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = -1 Query: 256 MSLRHPSAAP-RTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRP 98 MS P+ A RTCR++WCYQC RA+R+I PS+D+ CPRC+GRFLHEID P P Sbjct: 1 MSATTPAPARHRTCRMYWCYQCGRALRIISYPSTDVFCPRCFGRFLHEID-PTP 53 >ref|XP_003573045.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brachypodium distachyon] Length = 328 Score = 73.9 bits (180), Expect = 2e-11 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 226 RTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPR 95 RTCR++WCY C RA+R+I P++D+ CPRC+GRFLHEID P PR Sbjct: 13 RTCRMYWCYACGRALRIISYPATDVFCPRCFGRFLHEID-PPPR 55 >ref|XP_006472751.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Citrus sinensis] Length = 358 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = -1 Query: 238 SAAPRTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPRLVIEFT 77 + A R L+WCYQCHRAVR+ + S+I CPRC G F+ EI++ RPRLV++FT Sbjct: 23 NGANRNYPLYWCYQCHRAVRISSTNPSEIACPRCSGHFVSEIEISRPRLVVDFT 76 >ref|XP_006434154.1| hypothetical protein CICLE_v10003221mg [Citrus clementina] gi|557536276|gb|ESR47394.1| hypothetical protein CICLE_v10003221mg [Citrus clementina] Length = 380 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = -1 Query: 238 SAAPRTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPRLVIEFT 77 + A R L+WCYQCHRAVR+ + S+I CPRC G F+ EI++ RPRLV++FT Sbjct: 23 NGANRNYPLYWCYQCHRAVRISSTNPSEIACPRCSGHFVSEIEISRPRLVVDFT 76 >ref|NP_001149547.1| RHC1A [Zea mays] gi|195627928|gb|ACG35794.1| RHC1A [Zea mays] Length = 318 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/48 (62%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = -1 Query: 235 AAPRTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLH-EIDLPRPR 95 A RTCR +WCYQC RA+R+I PS+D+ CPRC+GRFLH E+D P R Sbjct: 9 ARHRTCRTYWCYQCGRALRIISCPSTDVFCPRCFGRFLHEEVDPPTAR 56 >gb|EOY16234.1| RING/U-box superfamily protein, putative [Theobroma cacao] Length = 356 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/54 (51%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = -1 Query: 235 AAP-RTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPRLVIEFT 77 AAP R +L+WCY CH+AVR+ + S+I+CPRC+G+F+ E+++ RPR+V++FT Sbjct: 16 AAPERNLQLYWCYNCHQAVRIASTNPSEIICPRCFGQFVCEMEINRPRMVVDFT 69 >ref|XP_004499404.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cicer arietinum] Length = 322 Score = 70.1 bits (170), Expect = 3e-10 Identities = 26/50 (52%), Positives = 41/50 (82%) Frame = -1 Query: 226 RTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPRLVIEFT 77 R +L+WC+QC+R VR+ SS+++CPRC+G+F+ EI++P PRLV++FT Sbjct: 15 RNFQLYWCFQCNRTVRVAPDNSSNLICPRCFGQFICEINIPTPRLVVDFT 64 >ref|XP_003601068.1| RING finger protein [Medicago truncatula] gi|355490116|gb|AES71319.1| RING finger protein [Medicago truncatula] Length = 328 Score = 70.1 bits (170), Expect = 3e-10 Identities = 27/50 (54%), Positives = 42/50 (84%) Frame = -1 Query: 226 RTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPRLVIEFT 77 R +L++C+QC+R VR+ SSD++CPRC+G+F+ EI++PRPRLV++FT Sbjct: 15 RNFQLYYCFQCNRTVRVAPYNSSDLICPRCFGQFICEINIPRPRLVVDFT 64 >ref|XP_002513785.1| zinc finger protein, putative [Ricinus communis] gi|223546871|gb|EEF48368.1| zinc finger protein, putative [Ricinus communis] Length = 382 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/62 (46%), Positives = 41/62 (66%) Frame = -1 Query: 265 PSSMSLRHPSAAPRTCRLFWCYQCHRAVRLICSPSSDILCPRCYGRFLHEIDLPRPRLVI 86 P +R A RT + +WCYQCHR VR+ S S+I+CPRC +FL E+++ R RLV+ Sbjct: 5 PPRTRIRTYDATTRTFQPYWCYQCHRMVRIAASDPSEIICPRCSSQFLCELEMNRQRLVV 64 Query: 85 EF 80 +F Sbjct: 65 DF 66 >dbj|BAD35703.1| zinc finger-like [Oryza sativa Japonica Group] Length = 331 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/46 (60%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = -1 Query: 226 RTCRLFWCYQCHRAVRLIC-SPSSDILCPRCYGRFLHEIDLPRPRL 92 R L+WCY C RA+R++ S +SD+ CPRC+GRFLHEIDLP PR+ Sbjct: 15 RRWNLYWCYVCRRALRVVVPSATSDVYCPRCFGRFLHEIDLPVPRV 60