BLASTX nr result
ID: Zingiber24_contig00041868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00041868 (429 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004964278.1| PREDICTED: NAC domain-containing protein 7-l... 56 6e-06 ref|XP_002437668.1| hypothetical protein SORBIDRAFT_10g000460 [S... 55 7e-06 >ref|XP_004964278.1| PREDICTED: NAC domain-containing protein 7-like [Setaria italica] Length = 339 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +2 Query: 194 AFDQVTDWRVLDKFVASQLSHDASKKAMCSEEAEHLLQVSQEQE 325 A DQVTDWRVLDKFVASQLSHDA+K + E + ++QV+++QE Sbjct: 278 AVDQVTDWRVLDKFVASQLSHDATKGVDYTGEGD-IIQVNEKQE 320 >ref|XP_002437668.1| hypothetical protein SORBIDRAFT_10g000460 [Sorghum bicolor] gi|241915891|gb|EER89035.1| hypothetical protein SORBIDRAFT_10g000460 [Sorghum bicolor] Length = 339 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = +2 Query: 194 AFDQVTDWRVLDKFVASQLSHDASKKAMCSEEAEHLLQVSQEQE 325 A DQVTDWRVLDKFVASQLS+DA+K ++E + +LQV+++QE Sbjct: 278 AVDQVTDWRVLDKFVASQLSNDAAKGVDYTDEGD-ILQVNEKQE 320