BLASTX nr result
ID: Zingiber24_contig00041792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00041792 (287 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ11850.1| hypothetical protein PRUPE_ppa019423mg, partial [... 58 1e-06 >gb|EMJ11850.1| hypothetical protein PRUPE_ppa019423mg, partial [Prunus persica] Length = 518 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 284 DSATLVSLSNISAELGDWEHVTMIRSPMKGTRLKKEPGWSV 162 D+ T +SLSNI A++G WE V IRS MKGT ++KEPGWS+ Sbjct: 477 DAGTYISLSNICADVGQWEEVLKIRSQMKGTDVRKEPGWSL 517