BLASTX nr result
ID: Zingiber24_contig00041577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00041577 (302 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ17577.1| hypothetical protein PRUPE_ppa020947mg [Prunus pe... 75 1e-11 ref|XP_002274886.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 gb|ESW04582.1| hypothetical protein PHAVU_011G107600g [Phaseolus... 74 2e-11 ref|XP_003540859.1| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 ref|XP_004289150.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 ref|XP_004513547.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_002515711.1| pentatricopeptide repeat-containing protein,... 66 5e-09 >gb|EMJ17577.1| hypothetical protein PRUPE_ppa020947mg [Prunus persica] Length = 710 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/58 (60%), Positives = 46/58 (79%) Frame = -1 Query: 176 LSSLECGRLLESLTNSKSLRHGLQIHGHMVTSGVLVHNTYLRTKLCAMYAACGRVRQA 3 L+SL+CG++L+SLTN+KS G ++H MVTSG L++NTYL TKL A YA CGR+ QA Sbjct: 31 LTSLQCGKILQSLTNTKSFPKGQKLHALMVTSGNLLNNTYLSTKLAAFYANCGRMAQA 88 >ref|XP_002274886.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Vitis vinifera] Length = 736 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/64 (51%), Positives = 45/64 (70%) Frame = -1 Query: 194 PQWNHLLSSLECGRLLESLTNSKSLRHGLQIHGHMVTSGVLVHNTYLRTKLCAMYAACGR 15 P + L+SL+CG LL+S TN+KS + G Q+H HM++ +L +NTYL TKL A YA CG Sbjct: 51 PLQQYPLTSLQCGALLQSFTNTKSFKQGQQLHAHMISFSILENNTYLNTKLAAFYAGCGL 110 Query: 14 VRQA 3 + QA Sbjct: 111 MSQA 114 >gb|ESW04582.1| hypothetical protein PHAVU_011G107600g [Phaseolus vulgaris] Length = 700 Score = 73.9 bits (180), Expect = 2e-11 Identities = 40/80 (50%), Positives = 48/80 (60%) Frame = -1 Query: 242 TFPLDPDPCPSPSQAGPQWNHLLSSLECGRLLESLTNSKSLRHGLQIHGHMVTSGVLVHN 63 T L P PC + + LSSL+CG LL+SL+NSKSL Q+H + T G L HN Sbjct: 6 TTALLPKPCSTTT---------LSSLQCGILLQSLSNSKSLTQAQQLHAQVTTGGTLRHN 56 Query: 62 TYLRTKLCAMYAACGRVRQA 3 TYL TKL A YAACG + A Sbjct: 57 TYLATKLAACYAACGHMLHA 76 >ref|XP_003540859.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Glycine max] Length = 701 Score = 72.8 bits (177), Expect = 4e-11 Identities = 35/64 (54%), Positives = 40/64 (62%) Frame = -1 Query: 194 PQWNHLLSSLECGRLLESLTNSKSLRHGLQIHGHMVTSGVLVHNTYLRTKLCAMYAACGR 15 P SL+CG LL+SLTNSKSL LQ+H H+ T G L NTYL TKL A YA CG Sbjct: 14 PSSTSTFDSLQCGTLLQSLTNSKSLTQALQLHAHVTTGGTLRRNTYLATKLAACYAVCGH 73 Query: 14 VRQA 3 + A Sbjct: 74 MPYA 77 >ref|XP_004289150.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Fragaria vesca subsp. vesca] Length = 710 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -1 Query: 173 SSLECGRLLESLTNSKSLRHGLQIHGHMVTSGVLVHNTYLRTKLCAMYAACGRVRQA 3 +SL CG +L+SLTN+KSL G ++H M TSG L+HNTYL TKL A YA CG++ QA Sbjct: 32 TSLRCGAILQSLTNTKSLPKGQKLHSLMATSGNLLHNTYLTTKLAAFYANCGQMPQA 88 >ref|XP_004513547.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cicer arietinum] Length = 743 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/58 (51%), Positives = 42/58 (72%) Frame = -1 Query: 176 LSSLECGRLLESLTNSKSLRHGLQIHGHMVTSGVLVHNTYLRTKLCAMYAACGRVRQA 3 L SL+CG LL++LTNSK + Q+H +++ S L+HNTYL TKL + YA+CG + QA Sbjct: 32 LQSLQCGTLLQALTNSKFITQTQQLHAYLIISATLLHNTYLSTKLASCYASCGFMHQA 89 >ref|XP_002515711.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545148|gb|EEF46658.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 462 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/58 (51%), Positives = 43/58 (74%) Frame = -1 Query: 176 LSSLECGRLLESLTNSKSLRHGLQIHGHMVTSGVLVHNTYLRTKLCAMYAACGRVRQA 3 L+SL+CG +L++LT+ KS G Q+H +++TSG L +NTYL TKL A YA+CG + A Sbjct: 39 LTSLQCGTVLQTLTSIKSFTKGQQLHAYIITSGNLQNNTYLSTKLAAFYASCGLMAAA 96