BLASTX nr result
ID: Zingiber24_contig00041447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00041447 (334 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857186.1| hypothetical protein AMTR_s00065p00184910 [A... 56 6e-06 >ref|XP_006857186.1| hypothetical protein AMTR_s00065p00184910 [Amborella trichopoda] gi|548861269|gb|ERN18653.1| hypothetical protein AMTR_s00065p00184910 [Amborella trichopoda] Length = 473 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/58 (56%), Positives = 36/58 (62%) Frame = -3 Query: 332 ISLASAISSATCRPRPPLSLNLRHPAAGDAPPSPSISALTVQSSNAGSADADGGKDRA 159 ISLASAISSATC R P S+ L P D P SPS+S LTVQS+ A D KD A Sbjct: 412 ISLASAISSATCHTRNPSSV-LMGPTNADVPSSPSMSVLTVQSAMANGTDVGAVKDAA 468