BLASTX nr result
ID: Zingiber24_contig00041435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00041435 (631 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006848621.1| hypothetical protein AMTR_s00171p00033150 [A... 82 1e-13 ref|XP_002268907.2| PREDICTED: katanin p80 WD40 repeat-containin... 82 1e-13 emb|CBI35338.3| unnamed protein product [Vitis vinifera] 82 1e-13 gb|EOX98980.1| Transducin/WD40 repeat-like superfamily protein [... 81 3e-13 ref|XP_004297695.1| PREDICTED: katanin p80 WD40 repeat-containin... 80 4e-13 ref|XP_003525689.2| PREDICTED: katanin p80 WD40 repeat-containin... 79 1e-12 ref|XP_002316424.2| hypothetical protein POPTR_0010s26190g [Popu... 78 2e-12 ref|XP_006603797.1| PREDICTED: katanin p80 WD40 repeat-containin... 77 3e-12 ref|XP_004147132.1| PREDICTED: katanin p80 WD40 repeat-containin... 77 3e-12 ref|XP_002311885.1| hypothetical protein POPTR_0008s00290g [Popu... 76 7e-12 ref|XP_002513719.1| katanin P80 subunit, putative [Ricinus commu... 75 1e-11 ref|XP_006468674.1| PREDICTED: katanin p80 WD40 repeat-containin... 75 2e-11 ref|XP_006468672.1| PREDICTED: katanin p80 WD40 repeat-containin... 75 2e-11 gb|ESW22857.1| hypothetical protein PHAVU_004G000600g [Phaseolus... 75 2e-11 ref|XP_006448506.1| hypothetical protein CICLE_v10014294mg [Citr... 75 2e-11 ref|XP_004489185.1| PREDICTED: katanin p80 WD40 repeat-containin... 75 2e-11 gb|EMJ23140.1| hypothetical protein PRUPE_ppa001553mg [Prunus pe... 75 2e-11 ref|XP_006653028.1| PREDICTED: katanin p80 WD40 repeat-containin... 74 3e-11 ref|XP_006360856.1| PREDICTED: katanin p80 WD40 repeat-containin... 74 3e-11 ref|XP_004236878.1| PREDICTED: katanin p80 WD40 repeat-containin... 74 3e-11 >ref|XP_006848621.1| hypothetical protein AMTR_s00171p00033150 [Amborella trichopoda] gi|548851972|gb|ERN10202.1| hypothetical protein AMTR_s00171p00033150 [Amborella trichopoda] Length = 800 Score = 82.4 bits (202), Expect = 1e-13 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEVL 146 QAEQRLERCNLCFIELEK+K IPSL +KGGSVAK AQELNL LQ+VL Sbjct: 753 QAEQRLERCNLCFIELEKVKHAIPSLAKKGGSVAKFAQELNLTLQDVL 800 >ref|XP_002268907.2| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 1-like [Vitis vinifera] Length = 800 Score = 82.4 bits (202), Expect = 1e-13 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEVL 146 QAEQRLERCNLCFIELEKIK +P+LTR+GGSVAK AQELNLAL EVL Sbjct: 753 QAEQRLERCNLCFIELEKIKHCLPALTRRGGSVAKLAQELNLALLEVL 800 >emb|CBI35338.3| unnamed protein product [Vitis vinifera] Length = 989 Score = 82.4 bits (202), Expect = 1e-13 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEVL 146 QAEQRLERCNLCFIELEKIK +P+LTR+GGSVAK AQELNLAL EVL Sbjct: 942 QAEQRLERCNLCFIELEKIKHCLPALTRRGGSVAKLAQELNLALLEVL 989 >gb|EOX98980.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] Length = 1199 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/47 (78%), Positives = 45/47 (95%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEV 143 +AEQR ERCNLCFIELEK+K+ +P+LTR+GGSVAK+AQELNLA+QEV Sbjct: 808 EAEQRFERCNLCFIELEKVKRCLPTLTRRGGSVAKSAQELNLAIQEV 854 >ref|XP_004297695.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Fragaria vesca subsp. vesca] Length = 795 Score = 80.5 bits (197), Expect = 4e-13 Identities = 37/47 (78%), Positives = 45/47 (95%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEV 143 +AEQRLERCNLCF+ELEK+K +P+LTR+GGS+AK+AQELNLALQEV Sbjct: 748 EAEQRLERCNLCFMELEKVKGCLPALTRRGGSIAKSAQELNLALQEV 794 >ref|XP_003525689.2| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Glycine max] Length = 759 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/48 (75%), Positives = 45/48 (93%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEVL 146 +AE RLERCNLCF ELEK+K+ +PSL+R+GGS+AK+AQELNLALQ+VL Sbjct: 712 EAENRLERCNLCFTELEKVKRFLPSLSRRGGSIAKSAQELNLALQDVL 759 >ref|XP_002316424.2| hypothetical protein POPTR_0010s26190g [Populus trichocarpa] gi|550330656|gb|EEF02595.2| hypothetical protein POPTR_0010s26190g [Populus trichocarpa] Length = 728 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEV 143 +AEQRLERCN+CF+ELEK+K+ + +LTRKGGSVAK AQELNLALQEV Sbjct: 681 EAEQRLERCNICFVELEKVKRCLLTLTRKGGSVAKYAQELNLALQEV 727 >ref|XP_006603797.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Glycine max] Length = 759 Score = 77.4 bits (189), Expect = 3e-12 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEV 143 +AE RLERCNLCF ELEK+K+ +PSL+R+GGS+AK+AQELNLALQ+V Sbjct: 712 EAENRLERCNLCFTELEKVKRFLPSLSRRGGSIAKSAQELNLALQDV 758 >ref|XP_004147132.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Cucumis sativus] gi|449524677|ref|XP_004169348.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Cucumis sativus] Length = 795 Score = 77.4 bits (189), Expect = 3e-12 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQE 140 +AEQRLERCNLCFIELEK+K+ +P+L RK GSVAK+AQELNLALQE Sbjct: 748 EAEQRLERCNLCFIELEKVKRCLPALIRKRGSVAKSAQELNLALQE 793 >ref|XP_002311885.1| hypothetical protein POPTR_0008s00290g [Populus trichocarpa] gi|222851705|gb|EEE89252.1| hypothetical protein POPTR_0008s00290g [Populus trichocarpa] Length = 802 Score = 76.3 bits (186), Expect = 7e-12 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEV 143 +AEQRLERCN+CF+ELEK+K+ + +LTRKGGSVAK A ELNLALQEV Sbjct: 755 EAEQRLERCNICFVELEKVKRCLLTLTRKGGSVAKFAHELNLALQEV 801 >ref|XP_002513719.1| katanin P80 subunit, putative [Ricinus communis] gi|223547170|gb|EEF48666.1| katanin P80 subunit, putative [Ricinus communis] Length = 803 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQE 140 +AEQRLERCNLCF+ELEK+K+ +P+L R+GGSVAK QELNLALQ+ Sbjct: 756 EAEQRLERCNLCFVELEKVKRCLPTLMRRGGSVAKITQELNLALQD 801 >ref|XP_006468674.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X3 [Citrus sinensis] Length = 811 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEV 143 +AEQR+ERCN CFIELEK+K +P+L R+GGSVAK+AQELNLALQ+V Sbjct: 764 EAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDV 810 >ref|XP_006468672.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Citrus sinensis] Length = 819 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEV 143 +AEQR+ERCN CFIELEK+K +P+L R+GGSVAK+AQELNLALQ+V Sbjct: 772 EAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDV 818 >gb|ESW22857.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris] gi|561024173|gb|ESW22858.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris] Length = 759 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/47 (72%), Positives = 44/47 (93%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEV 143 +AE+RLERCNLCF ELEK+K+ +PSL+R+GGS+AK+A ELNLALQ+V Sbjct: 712 EAEKRLERCNLCFPELEKVKRFLPSLSRRGGSIAKSAHELNLALQDV 758 >ref|XP_006448506.1| hypothetical protein CICLE_v10014294mg [Citrus clementina] gi|557551117|gb|ESR61746.1| hypothetical protein CICLE_v10014294mg [Citrus clementina] Length = 818 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEV 143 +AEQR+ERCN CFIELEK+K +P+L R+GGSVAK+AQELNLALQ+V Sbjct: 772 EAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDV 818 >ref|XP_004489185.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Cicer arietinum] Length = 747 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEV 143 +AE RLERCNLCF+ELEK+K+ +PSL R+GGS+AK A ELNLALQ+V Sbjct: 700 EAENRLERCNLCFVELEKVKRFLPSLMRRGGSIAKFAHELNLALQDV 746 >gb|EMJ23140.1| hypothetical protein PRUPE_ppa001553mg [Prunus persica] Length = 803 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEV 143 +AEQRLERCN CF+ELEK+K + +LTR+GGS+AK+AQELNLALQEV Sbjct: 756 EAEQRLERCNNCFMELEKVKTCLSALTRRGGSIAKSAQELNLALQEV 802 >ref|XP_006653028.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Oryza brachyantha] Length = 937 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEVL 146 QAEQR ERCNLCFIELEK+K K+PSL+R+ G+VA TAQEL+L QE++ Sbjct: 890 QAEQRRERCNLCFIELEKVKNKLPSLSRRKGAVANTAQELSLVFQELM 937 >ref|XP_006360856.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Solanum tuberosum] Length = 811 Score = 73.9 bits (180), Expect = 3e-11 Identities = 34/47 (72%), Positives = 43/47 (91%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEV 143 +AE+R+ER NLCFIELEK+K +P+L+R+GGS+AKTAQELNLAL EV Sbjct: 764 EAEKRMERYNLCFIELEKVKSCLPALSRRGGSIAKTAQELNLALHEV 810 >ref|XP_004236878.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Solanum lycopersicum] Length = 810 Score = 73.9 bits (180), Expect = 3e-11 Identities = 34/47 (72%), Positives = 43/47 (91%) Frame = +3 Query: 3 QAEQRLERCNLCFIELEKIKQKIPSLTRKGGSVAKTAQELNLALQEV 143 +AE+R+ER NLCFIELEK+K +P+L+R+GGS+AKTAQELNLAL EV Sbjct: 763 EAEKRMERYNLCFIELEKVKSCLPALSRRGGSIAKTAQELNLALHEV 809