BLASTX nr result
ID: Zingiber24_contig00041208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00041208 (231 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006850825.1| hypothetical protein AMTR_s00025p00127670 [A... 87 2e-15 ref|XP_002274008.1| PREDICTED: mitochondrial ubiquitin ligase ac... 83 4e-14 emb|CAN61807.1| hypothetical protein VITISV_014294 [Vitis vinifera] 83 4e-14 ref|XP_004242326.1| PREDICTED: mitochondrial ubiquitin ligase ac... 82 7e-14 ref|XP_004242325.1| PREDICTED: mitochondrial ubiquitin ligase ac... 82 7e-14 ref|XP_006352789.1| PREDICTED: mitochondrial ubiquitin ligase ac... 82 1e-13 ref|XP_006352786.1| PREDICTED: mitochondrial ubiquitin ligase ac... 82 1e-13 ref|XP_003562554.1| PREDICTED: mitochondrial ubiquitin ligase ac... 77 2e-12 ref|XP_003562553.1| PREDICTED: mitochondrial ubiquitin ligase ac... 77 2e-12 ref|XP_004958531.1| PREDICTED: mitochondrial ubiquitin ligase ac... 75 9e-12 ref|XP_004958530.1| PREDICTED: mitochondrial ubiquitin ligase ac... 75 9e-12 tpg|DAA41624.1| TPA: hypothetical protein ZEAMMB73_684695 [Zea m... 75 9e-12 ref|XP_002463293.1| hypothetical protein SORBIDRAFT_02g041380 [S... 75 9e-12 gb|EOX94848.1| E3 Ubiquitin ligase family protein isoform 2 [The... 75 1e-11 gb|EOX94847.1| E3 Ubiquitin ligase family protein isoform 1 [The... 75 1e-11 gb|EMT04556.1| hypothetical protein F775_26748 [Aegilops tauschii] 74 2e-11 gb|EMS68860.1| Mitochondrial ubiquitin ligase activator of NFKB ... 74 2e-11 gb|EMJ02448.1| hypothetical protein PRUPE_ppa008230mg [Prunus pe... 74 2e-11 ref|XP_006658048.1| PREDICTED: mitochondrial ubiquitin ligase ac... 73 5e-11 ref|XP_006444143.1| hypothetical protein CICLE_v10020955mg [Citr... 73 5e-11 >ref|XP_006850825.1| hypothetical protein AMTR_s00025p00127670 [Amborella trichopoda] gi|548854496|gb|ERN12406.1| hypothetical protein AMTR_s00025p00127670 [Amborella trichopoda] Length = 310 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 MIPW GL C SAA L+LLGR++GR++D LKSVTRVN LKDL++LLDT CKV+PLV Sbjct: 1 MIPWGGLSCCLSAAALYLLGRNSGRDADVLKSVTRVNQLKDLSLLLDTACKVLPLV 56 >ref|XP_002274008.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Vitis vinifera] gi|296086688|emb|CBI32323.3| unnamed protein product [Vitis vinifera] Length = 343 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 MIPW G+ C SAA L+LLGRS+GR+++ALKSVTRV LKDL LLDT CKV+PLV Sbjct: 1 MIPWGGISCCLSAAALYLLGRSSGRDAEALKSVTRVQQLKDLVQLLDTACKVLPLV 56 >emb|CAN61807.1| hypothetical protein VITISV_014294 [Vitis vinifera] Length = 202 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 MIPW G+ C SAA L+LLGRS+GR+++ALKSVTRV LKDL LLDT CKV+PLV Sbjct: 1 MIPWGGISCCLSAAALYLLGRSSGRDAEALKSVTRVQQLKDLVQLLDTACKVLPLV 56 >ref|XP_004242326.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like isoform 2 [Solanum lycopersicum] Length = 341 Score = 82.0 bits (201), Expect = 7e-14 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 M+PW+GL C SAA L+LLGRS+GR+++ LKSVTRVN LKDLA LLDT KV+PLV Sbjct: 1 MVPWAGLSCCLSAAALYLLGRSSGRDAEVLKSVTRVNQLKDLAQLLDTASKVLPLV 56 >ref|XP_004242325.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like isoform 1 [Solanum lycopersicum] Length = 349 Score = 82.0 bits (201), Expect = 7e-14 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 M+PW+GL C SAA L+LLGRS+GR+++ LKSVTRVN LKDLA LLDT KV+PLV Sbjct: 1 MVPWAGLSCCLSAAALYLLGRSSGRDAEVLKSVTRVNQLKDLAQLLDTASKVLPLV 56 >ref|XP_006352789.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform X4 [Solanum tuberosum] Length = 320 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 M+PW GL C SAA L+LLGRS+GR+++ LKSVTRVN LKDLA LLDT KV+PLV Sbjct: 1 MVPWGGLSCCLSAAALYLLGRSSGRDAEVLKSVTRVNQLKDLAQLLDTASKVLPLV 56 >ref|XP_006352786.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform X1 [Solanum tuberosum] gi|565372411|ref|XP_006352787.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform X2 [Solanum tuberosum] gi|565372413|ref|XP_006352788.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform X3 [Solanum tuberosum] Length = 342 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 M+PW GL C SAA L+LLGRS+GR+++ LKSVTRVN LKDLA LLDT KV+PLV Sbjct: 1 MVPWGGLSCCLSAAALYLLGRSSGRDAEVLKSVTRVNQLKDLAQLLDTASKVLPLV 56 >ref|XP_003562554.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform 2 [Brachypodium distachyon] Length = 331 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/56 (62%), Positives = 45/56 (80%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 M+PW G+GC SAA L+LLGRS+GR+++ L+SVTR LKDLA +LDT KV+PLV Sbjct: 2 MVPWGGVGCCLSAAALYLLGRSSGRDAEVLRSVTRTGSLKDLAAILDTASKVLPLV 57 >ref|XP_003562553.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform 1 [Brachypodium distachyon] Length = 343 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/56 (62%), Positives = 45/56 (80%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 M+PW G+GC SAA L+LLGRS+GR+++ L+SVTR LKDLA +LDT KV+PLV Sbjct: 2 MVPWGGVGCCLSAAALYLLGRSSGRDAEVLRSVTRTGSLKDLAAILDTASKVLPLV 57 >ref|XP_004958531.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform X2 [Setaria italica] Length = 347 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 MIPW G+GC SAA L+LLGRS+GR+++ L+SV R +KDLA +LDT KV+PLV Sbjct: 2 MIPWGGVGCCLSAAALYLLGRSSGRDAEVLRSVARAGSMKDLAAILDTASKVLPLV 57 >ref|XP_004958530.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform X1 [Setaria italica] Length = 343 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 MIPW G+GC SAA L+LLGRS+GR+++ L+SV R +KDLA +LDT KV+PLV Sbjct: 2 MIPWGGVGCCLSAAALYLLGRSSGRDAEVLRSVARAGSMKDLAAILDTASKVLPLV 57 >tpg|DAA41624.1| TPA: hypothetical protein ZEAMMB73_684695 [Zea mays] Length = 343 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 MIPW G+GC SAA L+LLGRS+GR+++ L+SV R +KDLA +LDT KV+PLV Sbjct: 2 MIPWGGVGCCLSAAALYLLGRSSGRDAEVLRSVARAGSMKDLAAILDTASKVLPLV 57 >ref|XP_002463293.1| hypothetical protein SORBIDRAFT_02g041380 [Sorghum bicolor] gi|241926670|gb|EER99814.1| hypothetical protein SORBIDRAFT_02g041380 [Sorghum bicolor] Length = 343 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 MIPW G+GC SAA L+LLGRS+GR+++ L+SV R +KDLA +LDT KV+PLV Sbjct: 2 MIPWGGVGCCLSAAALYLLGRSSGRDAEVLRSVARAGSMKDLAAILDTASKVLPLV 57 >gb|EOX94848.1| E3 Ubiquitin ligase family protein isoform 2 [Theobroma cacao] Length = 279 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/56 (62%), Positives = 44/56 (78%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 MIPW GL C S A L+LLGRS+GR+++ LK+VTRVN LK+LA LLD KV+PL+ Sbjct: 1 MIPWGGLSCCLSGAALYLLGRSSGRDAELLKTVTRVNQLKELAQLLDLESKVLPLI 56 >gb|EOX94847.1| E3 Ubiquitin ligase family protein isoform 1 [Theobroma cacao] Length = 342 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/56 (62%), Positives = 44/56 (78%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 MIPW GL C S A L+LLGRS+GR+++ LK+VTRVN LK+LA LLD KV+PL+ Sbjct: 1 MIPWGGLSCCLSGAALYLLGRSSGRDAELLKTVTRVNQLKELAQLLDLESKVLPLI 56 >gb|EMT04556.1| hypothetical protein F775_26748 [Aegilops tauschii] Length = 769 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/56 (58%), Positives = 44/56 (78%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 ++PW G+GC SAA L+LLGRS+GR+++ L+SV R LKDLA +LDT KV+PLV Sbjct: 2 LVPWGGVGCCLSAAALYLLGRSSGRDAEVLRSVARTGSLKDLAAILDTASKVLPLV 57 >gb|EMS68860.1| Mitochondrial ubiquitin ligase activator of NFKB 1 [Triticum urartu] Length = 341 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/56 (58%), Positives = 44/56 (78%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 ++PW G+GC SAA L+LLGRS+GR+++ L+SV R LKDLA +LDT KV+PLV Sbjct: 2 LVPWGGVGCCLSAAALYLLGRSSGRDAEVLRSVARTGSLKDLAAILDTASKVLPLV 57 >gb|EMJ02448.1| hypothetical protein PRUPE_ppa008230mg [Prunus persica] Length = 340 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/56 (62%), Positives = 45/56 (80%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 M+PW GL C SAA L+LLGRS+GR++D LKS TR+N LK+LA LLD+ C ++PLV Sbjct: 1 MLPWGGLSCCLSAAALYLLGRSSGRDADILKSATRINQLKELAKLLDSEC-ILPLV 55 >ref|XP_006658048.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Oryza brachyantha] Length = 343 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/56 (58%), Positives = 43/56 (76%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 +IPW G+GC SAA L+LLGRS+GR+++ L+SV R KDLA +LDT KV+PLV Sbjct: 2 LIPWGGVGCCLSAAALYLLGRSSGRDAEVLRSVARAGSTKDLAAILDTASKVLPLV 57 >ref|XP_006444143.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] gi|567903312|ref|XP_006444144.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] gi|568852219|ref|XP_006479777.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like [Citrus sinensis] gi|557546405|gb|ESR57383.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] gi|557546406|gb|ESR57384.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] Length = 344 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/56 (58%), Positives = 44/56 (78%) Frame = -1 Query: 168 MIPWSGLGCSASAAVLWLLGRSNGRESDALKSVTRVNHLKDLAILLDTPCKVVPLV 1 MIPW G+ C S A L+LLGRS+GR+++ LK+VTRVN LK+LA LLD+ KV+P + Sbjct: 1 MIPWGGISCCLSGAALYLLGRSSGRDAELLKTVTRVNQLKELAHLLDSGSKVLPFI 56