BLASTX nr result
ID: Zingiber24_contig00040869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00040869 (472 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002457118.1| hypothetical protein SORBIDRAFT_03g001590 [S... 56 6e-06 >ref|XP_002457118.1| hypothetical protein SORBIDRAFT_03g001590 [Sorghum bicolor] gi|241929093|gb|EES02238.1| hypothetical protein SORBIDRAFT_03g001590 [Sorghum bicolor] Length = 174 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/72 (43%), Positives = 44/72 (61%) Frame = +2 Query: 140 RMSQMEVVKNKKGAIRVKVVLSKEEAAQLLTLCACHKESMAIKTVHRLGMLQTPGRRQSY 319 R ++V K KG +RVKVVL+KEEAA+LL+L ++ A + V + ++ R + Sbjct: 101 RRGDLQVKKGNKGVVRVKVVLTKEEAARLLSLTVGGQKHTAAQIVAEMRKMEA-RRAAAN 159 Query: 320 CQWRPVLASIPE 355 WRP LASIPE Sbjct: 160 AAWRPALASIPE 171