BLASTX nr result
ID: Zingiber24_contig00040488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00040488 (251 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305215.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_004142210.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_002531339.1| pentatricopeptide repeat-containing protein,... 57 2e-06 ref|XP_006429052.1| hypothetical protein CICLE_v10013605mg [Citr... 57 3e-06 ref|XP_006403663.1| hypothetical protein EUTSA_v10010142mg [Eutr... 57 3e-06 ref|XP_006292855.1| hypothetical protein CARUB_v10019115mg [Caps... 57 3e-06 ref|NP_190938.1| protein MATERNAL EFFECT EMBRYO ARREST 40 [Arabi... 57 3e-06 ref|XP_002876221.1| hypothetical protein ARALYDRAFT_906766 [Arab... 57 3e-06 gb|EOY07590.1| Pentatricopeptide repeat (PPR) superfamily protei... 56 4e-06 gb|AGG38110.1| maternal effect embryo arrest 40 protein [Dimocar... 56 4e-06 emb|CBX25230.1| hypothetical_protein [Oryza brachyantha] 55 1e-05 >ref|XP_004305215.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 761 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/69 (44%), Positives = 43/69 (62%) Frame = -2 Query: 250 MLAEGLISLGMEDDLHKVALLIMEKASLSDNEFSTLKSLLEMRKFRDALTTFDXXXXXXX 71 MLAEGL +L MED L K+ +IMEKA +SD+E S ++ L++RKF+DAL T Sbjct: 693 MLAEGLYALSMEDTLIKLVDMIMEKARVSDSEASMIRGFLKIRKFKDALATLGGILNSQR 752 Query: 70 XXXXSWTQS 44 WT++ Sbjct: 753 PRKSYWTRN 761 >ref|XP_004142210.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Cucumis sativus] gi|449525343|ref|XP_004169677.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Cucumis sativus] Length = 768 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -2 Query: 250 MLAEGLISLGMEDDLHKVALLIMEKASLSDNEFSTLKSLLEMRKFRDALTT 98 MLAEGL +L M+D L K+ +IMEKA S+ E ST++ L++RKF+DAL+T Sbjct: 699 MLAEGLCTLSMDDTLVKLVDMIMEKAKFSEREISTIRGFLKIRKFQDALST 749 >ref|XP_002531339.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529061|gb|EEF31046.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 630 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = -2 Query: 250 MLAEGLISLGMEDDLHKVALLIMEKASLSDNEFSTLKSLLEMRKFRDALTT 98 MLAEGL SL MED L K+ L+MEKA+ S NE ++ L++RKF+DAL T Sbjct: 565 MLAEGLCSLSMEDTLIKLVDLVMEKANFSQNEVVMIRGFLKIRKFQDALAT 615 >ref|XP_006429052.1| hypothetical protein CICLE_v10013605mg [Citrus clementina] gi|568854342|ref|XP_006480788.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Citrus sinensis] gi|557531109|gb|ESR42292.1| hypothetical protein CICLE_v10013605mg [Citrus clementina] Length = 768 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = -2 Query: 250 MLAEGLISLGMEDDLHKVALLIMEKASLSDNEFSTLKSLLEMRKFRDALTTF 95 MLAEGL+SLG E+ L ++ ++M+KA SD E S ++ L++RKF+DAL TF Sbjct: 697 MLAEGLVSLGKEETLVELIDMVMDKAKFSDRETSMVRGFLKIRKFQDALATF 748 >ref|XP_006403663.1| hypothetical protein EUTSA_v10010142mg [Eutrema salsugineum] gi|557104782|gb|ESQ45116.1| hypothetical protein EUTSA_v10010142mg [Eutrema salsugineum] Length = 754 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = -2 Query: 250 MLAEGLISLGMEDDLHKVALLIMEKASLSDNEFSTLKSLLEMRKFRDALTT 98 MLAEGL++L ME+ L K+ ++M+KA S+ E S +K LL++RKF+DAL T Sbjct: 687 MLAEGLLTLSMEETLVKLMNMVMQKAKFSEEEVSMVKGLLKIRKFQDALAT 737 >ref|XP_006292855.1| hypothetical protein CARUB_v10019115mg [Capsella rubella] gi|482561562|gb|EOA25753.1| hypothetical protein CARUB_v10019115mg [Capsella rubella] Length = 754 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = -2 Query: 250 MLAEGLISLGMEDDLHKVALLIMEKASLSDNEFSTLKSLLEMRKFRDALTT 98 MLAEGL++L ME+ L K+ ++M+KA S+ E S +K LL++RKF+DAL T Sbjct: 687 MLAEGLLTLSMEETLVKLVNMVMQKARFSEEEVSMVKGLLKIRKFQDALAT 737 >ref|NP_190938.1| protein MATERNAL EFFECT EMBRYO ARREST 40 [Arabidopsis thaliana] gi|75174107|sp|Q9LFF1.1|PP281_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g53700, chloroplastic; AltName: Full=Protein MATERNAL EFFECT EMBRYO ARREST 40; Flags: Precursor gi|6729521|emb|CAB67677.1| putative protein [Arabidopsis thaliana] gi|15982931|gb|AAL09812.1| AT3g53700/F4P12_400 [Arabidopsis thaliana] gi|332645608|gb|AEE79129.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 754 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = -2 Query: 250 MLAEGLISLGMEDDLHKVALLIMEKASLSDNEFSTLKSLLEMRKFRDALTT 98 MLAEGL++L ME+ L K+ ++M+KA S+ E S +K LL++RKF+DAL T Sbjct: 687 MLAEGLLTLSMEETLVKLVNMVMQKARFSEEEVSMVKGLLKIRKFQDALAT 737 >ref|XP_002876221.1| hypothetical protein ARALYDRAFT_906766 [Arabidopsis lyrata subsp. lyrata] gi|297322059|gb|EFH52480.1| hypothetical protein ARALYDRAFT_906766 [Arabidopsis lyrata subsp. lyrata] Length = 754 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = -2 Query: 250 MLAEGLISLGMEDDLHKVALLIMEKASLSDNEFSTLKSLLEMRKFRDALTT 98 MLAEGL++L ME+ L K+ ++M+KA S+ E S +K LL++RKF+DAL T Sbjct: 687 MLAEGLLTLSMEETLVKLVNMVMQKARFSEEEVSMVKGLLKIRKFQDALAT 737 >gb|EOY07590.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 752 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -2 Query: 250 MLAEGLISLGMEDDLHKVALLIMEKASLSDNEFSTLKSLLEMRKFRDAL 104 MLAEGL SL MED L K+ ++MEKA+ SD+E S ++ L +RKF+DAL Sbjct: 685 MLAEGLCSLSMEDTLVKLIDMVMEKANCSDSEVSIIRGFLRIRKFQDAL 733 >gb|AGG38110.1| maternal effect embryo arrest 40 protein [Dimocarpus longan] Length = 763 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -2 Query: 250 MLAEGLISLGMEDDLHKVALLIMEKASLSDNEFSTLKSLLEMRKFRDALTTF 95 MLAEGL SL MED L + ++M+KA S+NE S ++ L++RK+ DAL TF Sbjct: 696 MLAEGLCSLSMEDTLVDLVDMVMDKAKFSNNEVSMIRGFLKIRKYHDALATF 747 >emb|CBX25230.1| hypothetical_protein [Oryza brachyantha] Length = 746 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = -2 Query: 250 MLAEGLISLGMEDDLHKVALLIMEKASLSDNEFSTLKSLLEMRKFRDALTTF 95 MLAEGL++LGM+D + +I+EKA L D++ S ++ L++RKF DAL TF Sbjct: 681 MLAEGLLNLGMDDYFIRAIEIIIEKADLGDSDVSAIRGYLKIRKFYDALATF 732