BLASTX nr result
ID: Zingiber24_contig00040481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00040481 (347 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006386324.1| hypothetical protein POPTR_0002s07120g, part... 55 1e-05 >ref|XP_006386324.1| hypothetical protein POPTR_0002s07120g, partial [Populus trichocarpa] gi|550344459|gb|ERP64121.1| hypothetical protein POPTR_0002s07120g, partial [Populus trichocarpa] Length = 74 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 2/55 (3%) Frame = -2 Query: 310 FVSCSHGSSDRRGLRVSSIAKKN--PGYLTGFLPRGVPIPPSGPSKKHNSIGLQN 152 FV+ + GS + ++ + +N PG +GF P+G+PIPPSGPSKKHN IGL++ Sbjct: 15 FVNHTCGSRQTKIFKMIEPSSQNSSPGTFSGFFPKGMPIPPSGPSKKHNDIGLRS 69