BLASTX nr result
ID: Zingiber24_contig00040408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00040408 (411 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB88725.1| hypothetical protein L484_015415 [Morus notabilis] 57 2e-06 ref|XP_002528726.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >gb|EXB88725.1| hypothetical protein L484_015415 [Morus notabilis] Length = 81 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/71 (45%), Positives = 40/71 (56%) Frame = +1 Query: 103 MERLNTKLFWQNCCIMKDNERLRNKAXXXXXXXXXXXXXXXKKLAKANAKPDLNAFPVSK 282 MERLN+KL+ QNC IMK+NERLR KA +KL+K N+K + Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLSKGNSK--------NN 52 Query: 283 YNNNGDNAAPN 315 NNNG NA P+ Sbjct: 53 NNNNGKNAIPD 63 >ref|XP_002528726.1| conserved hypothetical protein [Ricinus communis] gi|223531820|gb|EEF33638.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 55.1 bits (131), Expect = 1e-05 Identities = 34/79 (43%), Positives = 41/79 (51%), Gaps = 8/79 (10%) Frame = +1 Query: 103 MERLNTKLFWQNCCIMKDNERLRNKAXXXXXXXXXXXXXXXKKLAKANAK--------PD 258 MERLN+KL+ QNC IMK+NERLR KA +KL K N+K PD Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLTKTNSKANASNNTIPD 60 Query: 259 LNAFPVSKYNNNGDNAAPN 315 LN S N N++PN Sbjct: 61 LNLSSTS--TQNPTNSSPN 77