BLASTX nr result
ID: Zingiber24_contig00040388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00040388 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK18571.1| TCP family transcription factor [Cyclamen persicum] 59 9e-07 gb|ESW05157.1| hypothetical protein PHAVU_011G156900g [Phaseolus... 58 1e-06 ref|NP_564624.2| TEOSINTE BRANCHED 1, cycloidea and PCF transcri... 55 7e-06 ref|XP_006852505.1| hypothetical protein AMTR_s00021p00158020 [A... 55 1e-05 >dbj|BAK18571.1| TCP family transcription factor [Cyclamen persicum] Length = 350 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/42 (71%), Positives = 30/42 (71%) Frame = +1 Query: 190 PRLPQTPSRYGSREKGAAVGEIVEVHGGHIVRSTGRKDRHSK 315 P PSR G R A GEIVEVHGGHIVRSTGRKDRHSK Sbjct: 7 PHRQPAPSRLGMRAPAGA-GEIVEVHGGHIVRSTGRKDRHSK 47 >gb|ESW05157.1| hypothetical protein PHAVU_011G156900g [Phaseolus vulgaris] Length = 381 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/55 (61%), Positives = 36/55 (65%) Frame = +1 Query: 151 VGYGQLSFLRHQPPRLPQTPSRYGSREKGAAVGEIVEVHGGHIVRSTGRKDRHSK 315 +G Q L HQ TPSR S +G VGEIVEV GGHIVRSTGRKDRHSK Sbjct: 1 MGESQNHLLLHQTA----TPSR--STMRGGGVGEIVEVQGGHIVRSTGRKDRHSK 49 >ref|NP_564624.2| TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 3 [Arabidopsis thaliana] gi|75192198|sp|Q9MAH8.1|TCP3_ARATH RecName: Full=Transcription factor TCP3 gi|7769872|gb|AAF69550.1|AC008007_25 F12M16.13 [Arabidopsis thaliana] gi|20466424|gb|AAM20529.1| putative flower development protein cycloidea [Arabidopsis thaliana] gi|23198116|gb|AAN15585.1| putative flower development protein cycloidea [Arabidopsis thaliana] gi|332194788|gb|AEE32909.1| TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 3 [Arabidopsis thaliana] Length = 391 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/48 (58%), Positives = 30/48 (62%) Frame = +1 Query: 172 FLRHQPPRLPQTPSRYGSREKGAAVGEIVEVHGGHIVRSTGRKDRHSK 315 FL P L + + E G GEIVEV GGHIVRSTGRKDRHSK Sbjct: 8 FLDSPSPPLLEMRHHQSATENGGGCGEIVEVQGGHIVRSTGRKDRHSK 55 >ref|XP_006852505.1| hypothetical protein AMTR_s00021p00158020 [Amborella trichopoda] gi|548856116|gb|ERN13972.1| hypothetical protein AMTR_s00021p00158020 [Amborella trichopoda] Length = 375 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +1 Query: 220 GSREKGAAVGEIVEVHGGHIVRSTGRKDRHSK 315 G R G VGEIVEV GGHIVRSTGRKDRHSK Sbjct: 2 GERRGGNTVGEIVEVEGGHIVRSTGRKDRHSK 33