BLASTX nr result
ID: Zingiber24_contig00040097
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00040097 (549 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350055.1| PREDICTED: uncharacterized protein LOC102580... 59 6e-07 ref|XP_006354042.1| PREDICTED: uncharacterized protein LOC102587... 56 5e-06 ref|XP_004237872.1| PREDICTED: uncharacterized protein LOC101267... 56 5e-06 gb|ESW18338.1| hypothetical protein PHAVU_006G032600g [Phaseolus... 56 6e-06 ref|XP_004237870.1| PREDICTED: uncharacterized protein LOC101267... 56 6e-06 gb|AFW73454.1| putative mitochondrial transcription termination ... 56 6e-06 ref|XP_003553152.1| PREDICTED: uncharacterized protein LOC100788... 56 6e-06 ref|NP_001169079.1| uncharacterized protein LOC100382920 [Zea ma... 56 6e-06 ref|XP_002454276.1| hypothetical protein SORBIDRAFT_04g027830 [S... 55 8e-06 >ref|XP_006350055.1| PREDICTED: uncharacterized protein LOC102580515 [Solanum tuberosum] Length = 369 Score = 59.3 bits (142), Expect = 6e-07 Identities = 27/56 (48%), Positives = 40/56 (71%) Frame = -2 Query: 548 SLDKRVIPRFQVLELLKSENLWTAKGTFFSYMRLSDKKFIEKFVLPYKEKVPKLVD 381 S++KRV+PR QVL++L + L K ++ + L +KKFIE FVLPYK++VP L + Sbjct: 306 SMEKRVVPRMQVLKILDEKKLERRKVALYTVVSLKEKKFIETFVLPYKDQVPDLYE 361 >ref|XP_006354042.1| PREDICTED: uncharacterized protein LOC102587183 [Solanum tuberosum] Length = 382 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/56 (46%), Positives = 39/56 (69%) Frame = -2 Query: 548 SLDKRVIPRFQVLELLKSENLWTAKGTFFSYMRLSDKKFIEKFVLPYKEKVPKLVD 381 SL+KRV+PR QVL++L L K ++ + LS+ KFI+ FVLPYK+++P L + Sbjct: 319 SLEKRVLPRMQVLKILDENKLERRKLALYTVVSLSETKFIDYFVLPYKDQIPDLYE 374 >ref|XP_004237872.1| PREDICTED: uncharacterized protein LOC101267803 [Solanum lycopersicum] Length = 412 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/58 (51%), Positives = 40/58 (68%) Frame = -2 Query: 548 SLDKRVIPRFQVLELLKSENLWTAKGTFFSYMRLSDKKFIEKFVLPYKEKVPKLVDIY 375 SLDKRVIPR QVL++LK + L K +F M +S+ F KFVLPYK+++P L + Y Sbjct: 350 SLDKRVIPRNQVLKVLKEKRL-VQKVSFSRAMYISEPMFRSKFVLPYKDEIPNLYESY 406 >gb|ESW18338.1| hypothetical protein PHAVU_006G032600g [Phaseolus vulgaris] Length = 393 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/58 (39%), Positives = 43/58 (74%) Frame = -2 Query: 548 SLDKRVIPRFQVLELLKSENLWTAKGTFFSYMRLSDKKFIEKFVLPYKEKVPKLVDIY 375 +L+KR+IPRF V+++LKS+ L + +F Y+ ++D F++KFV+ +++ +P L D+Y Sbjct: 326 NLEKRIIPRFSVIKILKSKGLLRSSLSFSYYICMTDNSFLKKFVISFQKDLPLLPDVY 383 >ref|XP_004237870.1| PREDICTED: uncharacterized protein LOC101267229 [Solanum lycopersicum] Length = 382 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/57 (43%), Positives = 40/57 (70%) Frame = -2 Query: 548 SLDKRVIPRFQVLELLKSENLWTAKGTFFSYMRLSDKKFIEKFVLPYKEKVPKLVDI 378 SL+KRV+PR QVL++L L K ++ + LS+ KFI+ +VLPYK+++P L ++ Sbjct: 319 SLEKRVLPRMQVLKILDENKLERRKLALYTIVSLSETKFIDYYVLPYKDQIPDLYEL 375 >gb|AFW73454.1| putative mitochondrial transcription termination factor family protein [Zea mays] Length = 390 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/58 (43%), Positives = 39/58 (67%) Frame = -2 Query: 548 SLDKRVIPRFQVLELLKSENLWTAKGTFFSYMRLSDKKFIEKFVLPYKEKVPKLVDIY 375 SL++R++PR VL +LK + L FF+ + +++KF+EKFV PY+E +P L D Y Sbjct: 321 SLERRIVPRHLVLMVLKEKGLVEQDRCFFNVVAPTEEKFLEKFVAPYEESIPGLADAY 378 >ref|XP_003553152.1| PREDICTED: uncharacterized protein LOC100788793 [Glycine max] Length = 404 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/58 (41%), Positives = 43/58 (74%) Frame = -2 Query: 548 SLDKRVIPRFQVLELLKSENLWTAKGTFFSYMRLSDKKFIEKFVLPYKEKVPKLVDIY 375 SL+KR+IPRF V+++L+S NL F S++ +++K F++KFV+ +++ +P L D+Y Sbjct: 337 SLEKRIIPRFSVIKILQSNNLPRNDFHFGSFICINEKNFLKKFVIKFQDDLPHLSDVY 394 >ref|NP_001169079.1| uncharacterized protein LOC100382920 [Zea mays] gi|223974813|gb|ACN31594.1| unknown [Zea mays] Length = 351 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/58 (43%), Positives = 39/58 (67%) Frame = -2 Query: 548 SLDKRVIPRFQVLELLKSENLWTAKGTFFSYMRLSDKKFIEKFVLPYKEKVPKLVDIY 375 SL++R++PR VL +LK + L FF+ + +++KF+EKFV PY+E +P L D Y Sbjct: 282 SLERRIVPRHLVLMVLKEKGLVEQDRCFFNVVAPTEEKFLEKFVAPYEESIPGLADAY 339 >ref|XP_002454276.1| hypothetical protein SORBIDRAFT_04g027830 [Sorghum bicolor] gi|241934107|gb|EES07252.1| hypothetical protein SORBIDRAFT_04g027830 [Sorghum bicolor] Length = 390 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/58 (43%), Positives = 38/58 (65%) Frame = -2 Query: 548 SLDKRVIPRFQVLELLKSENLWTAKGTFFSYMRLSDKKFIEKFVLPYKEKVPKLVDIY 375 SL++R++PR VL +LK + L FF+ + +++KF EKFV PY+E +P L D Y Sbjct: 321 SLERRIVPRHVVLTVLKEKGLVEQDRCFFNVVAPTEEKFFEKFVAPYEESIPGLADTY 378