BLASTX nr result
ID: Zingiber24_contig00039913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00039913 (488 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003567918.1| PREDICTED: cytochrome c oxidase assembly pro... 66 4e-09 ref|XP_004961253.1| PREDICTED: cytochrome c oxidase assembly pro... 65 9e-09 gb|EMT08547.1| hypothetical protein F775_27905 [Aegilops tauschii] 65 9e-09 dbj|BAK05956.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 9e-09 ref|XP_002468590.1| hypothetical protein SORBIDRAFT_01g048650 [S... 65 9e-09 gb|EEE56831.1| hypothetical protein OsJ_06434 [Oryza sativa Japo... 65 9e-09 gb|EEC73006.1| hypothetical protein OsI_06928 [Oryza sativa Indi... 65 9e-09 ref|NP_001046657.2| Os02g0313500 [Oryza sativa Japonica Group] g... 65 9e-09 gb|ACG38035.1| cytochrome c oxidase assembly protein COX19 [Zea ... 65 9e-09 gb|ACG25895.1| cytochrome c oxidase assembly protein COX19 [Zea ... 65 9e-09 ref|XP_002440230.1| hypothetical protein SORBIDRAFT_09g028140 [S... 64 2e-08 ref|XP_004985694.1| PREDICTED: cytochrome c oxidase assembly pro... 64 3e-08 gb|AFW79120.1| hypothetical protein ZEAMMB73_460562 [Zea mays] 64 3e-08 gb|ACG40852.1| cytochrome c oxidase assembly protein COX19 [Zea ... 64 3e-08 gb|EOY26880.1| Cytochrome c oxidase 19-1 isoform 2 [Theobroma ca... 63 4e-08 gb|EOY26879.1| Cytochrome c oxidase 19-1 isoform 1 [Theobroma ca... 63 4e-08 ref|XP_006390976.1| hypothetical protein EUTSA_v10019223mg [Eutr... 63 5e-08 gb|AAG51175.1|AC079285_8 hypothetical protein [Arabidopsis thali... 63 5e-08 ref|NP_564879.1| cytochrome c oxidase 19-1 [Arabidopsis thaliana... 63 5e-08 ref|NP_177133.1| cytochrome c oxidase 19-2 [Arabidopsis thaliana... 63 5e-08 >ref|XP_003567918.1| PREDICTED: cytochrome c oxidase assembly protein COX19-like [Brachypodium distachyon] Length = 101 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECDL KKEY+ACLKS Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKEYLACLKS 44 >ref|XP_004961253.1| PREDICTED: cytochrome c oxidase assembly protein COX19-like [Setaria italica] Length = 106 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLACLKS 44 >gb|EMT08547.1| hypothetical protein F775_27905 [Aegilops tauschii] Length = 116 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS Sbjct: 14 PVPPEKGVFPLDHLHECDLEKKDYLACLKS 43 >dbj|BAK05956.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 110 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS Sbjct: 19 PVPPEKGVFPLDHLHECDLEKKDYLACLKS 48 >ref|XP_002468590.1| hypothetical protein SORBIDRAFT_01g048650 [Sorghum bicolor] gi|241922444|gb|EER95588.1| hypothetical protein SORBIDRAFT_01g048650 [Sorghum bicolor] Length = 109 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLACLKS 44 >gb|EEE56831.1| hypothetical protein OsJ_06434 [Oryza sativa Japonica Group] Length = 185 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS Sbjct: 94 PVPPEKGVFPLDHLHECDLEKKDYLACLKS 123 >gb|EEC73006.1| hypothetical protein OsI_06928 [Oryza sativa Indica Group] Length = 185 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS Sbjct: 94 PVPPEKGVFPLDHLHECDLEKKDYLACLKS 123 >ref|NP_001046657.2| Os02g0313500 [Oryza sativa Japonica Group] gi|215767662|dbj|BAG99890.1| unnamed protein product [Oryza sativa Japonica Group] gi|255670833|dbj|BAF08571.2| Os02g0313500 [Oryza sativa Japonica Group] Length = 106 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLACLKS 44 >gb|ACG38035.1| cytochrome c oxidase assembly protein COX19 [Zea mays] gi|195652211|gb|ACG45573.1| cytochrome c oxidase assembly protein COX19 [Zea mays] Length = 109 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLACLKS 44 >gb|ACG25895.1| cytochrome c oxidase assembly protein COX19 [Zea mays] gi|195640054|gb|ACG39495.1| cytochrome c oxidase assembly protein COX19 [Zea mays] Length = 109 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECDL KK+Y+ACLKS Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLACLKS 44 >ref|XP_002440230.1| hypothetical protein SORBIDRAFT_09g028140 [Sorghum bicolor] gi|241945515|gb|EES18660.1| hypothetical protein SORBIDRAFT_09g028140 [Sorghum bicolor] Length = 99 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECDL KK+Y++CLKS Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLSCLKS 44 >ref|XP_004985694.1| PREDICTED: cytochrome c oxidase assembly protein COX19-like [Setaria italica] Length = 109 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECD KK+Y+ACLKS Sbjct: 15 PVPPEKGVFPLDHLHECDFEKKDYLACLKS 44 >gb|AFW79120.1| hypothetical protein ZEAMMB73_460562 [Zea mays] Length = 104 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECDL KK+Y+ CLKS Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLGCLKS 44 >gb|ACG40852.1| cytochrome c oxidase assembly protein COX19 [Zea mays] Length = 104 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKG+FPLDHLHECDL KK+Y+ CLKS Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLGCLKS 44 >gb|EOY26880.1| Cytochrome c oxidase 19-1 isoform 2 [Theobroma cacao] Length = 98 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKGIFPLDHLHECDL KKEY+ CLK+ Sbjct: 15 PVPPEKGIFPLDHLHECDLEKKEYLNCLKT 44 >gb|EOY26879.1| Cytochrome c oxidase 19-1 isoform 1 [Theobroma cacao] Length = 122 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 PVPPEKGIFPLDHLHECDL KKEY+ CLK+ Sbjct: 39 PVPPEKGIFPLDHLHECDLEKKEYLNCLKT 68 >ref|XP_006390976.1| hypothetical protein EUTSA_v10019223mg [Eutrema salsugineum] gi|557087410|gb|ESQ28262.1| hypothetical protein EUTSA_v10019223mg [Eutrema salsugineum] Length = 169 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 P+PPEKGIFPLDHLHECD KKEY+ CLKS Sbjct: 86 PIPPEKGIFPLDHLHECDAEKKEYLGCLKS 115 >gb|AAG51175.1|AC079285_8 hypothetical protein [Arabidopsis thaliana] Length = 135 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 P+PPEKGIFPLDHLHECD KKEY+ CLKS Sbjct: 52 PIPPEKGIFPLDHLHECDAEKKEYLGCLKS 81 >ref|NP_564879.1| cytochrome c oxidase 19-1 [Arabidopsis thaliana] gi|332196412|gb|AEE34533.1| cytochrome c oxidase 19-1 [Arabidopsis thaliana] Length = 113 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 P+PPEKGIFPLDHLHECD KKEY+ CLKS Sbjct: 30 PIPPEKGIFPLDHLHECDAEKKEYLGCLKS 59 >ref|NP_177133.1| cytochrome c oxidase 19-2 [Arabidopsis thaliana] gi|30697370|ref|NP_849852.1| cytochrome c oxidase 19-1 [Arabidopsis thaliana] gi|12325196|gb|AAG52547.1|AC013289_14 hypothetical protein; 34550-33586 [Arabidopsis thaliana] gi|26452002|dbj|BAC43091.1| unknown protein [Arabidopsis thaliana] gi|28416811|gb|AAO42936.1| At1g66590 [Arabidopsis thaliana] gi|117168179|gb|ABK32172.1| At1g69750 [Arabidopsis thaliana] gi|332196411|gb|AEE34532.1| cytochrome c oxidase 19-1 [Arabidopsis thaliana] gi|332196850|gb|AEE34971.1| cytochrome c oxidase 19-2 [Arabidopsis thaliana] Length = 98 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 91 PVPPEKGIFPLDHLHECDLAKKEYIACLKS 2 P+PPEKGIFPLDHLHECD KKEY+ CLKS Sbjct: 15 PIPPEKGIFPLDHLHECDAEKKEYLGCLKS 44