BLASTX nr result
ID: Zingiber24_contig00039013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00039013 (217 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002456026.1| hypothetical protein SORBIDRAFT_03g029080 [S... 55 7e-06 >ref|XP_002456026.1| hypothetical protein SORBIDRAFT_03g029080 [Sorghum bicolor] gi|241928001|gb|EES01146.1| hypothetical protein SORBIDRAFT_03g029080 [Sorghum bicolor] Length = 491 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/67 (43%), Positives = 42/67 (62%) Frame = -2 Query: 216 ERFRVGVQVSDKIRSATDPNQTIVMAAELAKAIGSIMDAGETAEGMRRRSRELAEKARAA 37 E +VGV V ++ + ++ +A+AIG +M GE AE +R +++EL EKAR A Sbjct: 405 ELLKVGVSVGSTDYASKLETRRVIGGEVIAEAIGRVMGDGEDAEAIREKAKELGEKARRA 464 Query: 36 VAKGGSS 16 VAKGGSS Sbjct: 465 VAKGGSS 471