BLASTX nr result
ID: Zingiber24_contig00038697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00038697 (353 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW68063.1| hypothetical protein ZEAMMB73_748248 [Zea mays] 56 4e-06 >gb|AFW68063.1| hypothetical protein ZEAMMB73_748248 [Zea mays] Length = 229 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = -1 Query: 350 CLLYVLVCKVEPRCPRCAAHVPVNDTNKKPRIDLNFSF 237 C LYVL+ + +PRCPRC +HVP +KKPRIDLN + Sbjct: 189 CFLYVLISRSDPRCPRCESHVPAPAVSKKPRIDLNVGY 226