BLASTX nr result
ID: Zingiber24_contig00038416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00038416 (311 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004891584.1| unnamed protein product (chloroplast) [Nicot... 60 3e-07 ref|YP_398843.1| hypothetical protein NitoCp007 [Nicotiana tomen... 60 4e-07 emb|CAJ32479.1| hypothetical protein [Nicotiana tabacum] 60 4e-07 >ref|YP_004891584.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|347453885|gb|AEO95543.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453996|gb|AEO95653.1| hypothetical protein [synthetic construct] Length = 90 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -2 Query: 148 ASGERGIRTLGTNNSYNGLAIRRFSPLSHLSKLQ 47 ++G+RGIRTLGT NSYNGLAIRRFSPLSHLS+L+ Sbjct: 52 SNGKRGIRTLGTINSYNGLAIRRFSPLSHLSQLK 85 >ref|YP_398843.1| hypothetical protein NitoCp007 [Nicotiana tomentosiformis] gi|80750905|dbj|BAE47981.1| hypothetical protein [Nicotiana tomentosiformis] Length = 90 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 145 SGERGIRTLGTNNSYNGLAIRRFSPLSHLSKLQ 47 +G+RGIRTLGT NSYNGLAIRRFSPLSHLS+L+ Sbjct: 53 NGKRGIRTLGTINSYNGLAIRRFSPLSHLSQLK 85 >emb|CAJ32479.1| hypothetical protein [Nicotiana tabacum] Length = 90 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 145 SGERGIRTLGTNNSYNGLAIRRFSPLSHLSKLQ 47 +G+RGIRTLGT NSYNGLAIRRFSPLSHLS+L+ Sbjct: 53 NGKRGIRTLGTINSYNGLAIRRFSPLSHLSQLK 85