BLASTX nr result
ID: Zingiber24_contig00038298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00038298 (218 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316399.2| hypothetical protein POPTR_0010s23570g [Popu... 57 2e-06 ref|XP_002534016.1| Pectate lyase precursor, putative [Ricinus c... 57 3e-06 ref|XP_002311060.2| hypothetical protein POPTR_0008s032602g, par... 55 7e-06 gb|EOY18836.1| Pectin lyase-like superfamily protein isoform 3, ... 55 1e-05 gb|EOY18834.1| Pectin lyase-like superfamily protein isoform 1 [... 55 1e-05 >ref|XP_002316399.2| hypothetical protein POPTR_0010s23570g [Populus trichocarpa] gi|550330449|gb|EEF02570.2| hypothetical protein POPTR_0010s23570g [Populus trichocarpa] Length = 496 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -2 Query: 130 HAHPDPDFVAREVQRQVAYS-NRRALLAAGDKDQCLTGNPIDDC 2 H HPDP+ VA +V+R+V S +RR LL+ +KDQC TGNPIDDC Sbjct: 33 HQHPDPEAVAEDVKRRVNASLSRRHLLSIQEKDQCQTGNPIDDC 76 >ref|XP_002534016.1| Pectate lyase precursor, putative [Ricinus communis] gi|223525981|gb|EEF28369.1| Pectate lyase precursor, putative [Ricinus communis] Length = 503 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = -2 Query: 130 HAHPDPDFVAREVQRQVAYS-NRRALLAAGDKDQCLTGNPIDDC 2 H HPDP+ +A++VQR + S +RR LL+ KDQC TGNPIDDC Sbjct: 34 HQHPDPESIAQDVQRTINASVSRRQLLSTLPKDQCQTGNPIDDC 77 >ref|XP_002311060.2| hypothetical protein POPTR_0008s032602g, partial [Populus trichocarpa] gi|550332326|gb|EEE88427.2| hypothetical protein POPTR_0008s032602g, partial [Populus trichocarpa] Length = 376 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 7/50 (14%) Frame = -2 Query: 130 HAHPDPDFVAREVQRQVAYSN-------RRALLAAGDKDQCLTGNPIDDC 2 H HPDP+ VA +V+RQ Y + RR LL+ +KDQC TGNPIDDC Sbjct: 33 HQHPDPEAVAEDVKRQDLYIHLVNASLSRRNLLSIQEKDQCQTGNPIDDC 82 >gb|EOY18836.1| Pectin lyase-like superfamily protein isoform 3, partial [Theobroma cacao] Length = 481 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/44 (56%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -2 Query: 130 HAHPDPDFVAREVQRQVAYS-NRRALLAAGDKDQCLTGNPIDDC 2 H HPDP+ V ++VQR++ S +RR L+ KDQC TGNPIDDC Sbjct: 18 HQHPDPESVVQDVQRRLNVSLSRRQALSVTQKDQCRTGNPIDDC 61 >gb|EOY18834.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao] gi|508726938|gb|EOY18835.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao] Length = 493 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/44 (56%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -2 Query: 130 HAHPDPDFVAREVQRQVAYS-NRRALLAAGDKDQCLTGNPIDDC 2 H HPDP+ V ++VQR++ S +RR L+ KDQC TGNPIDDC Sbjct: 30 HQHPDPESVVQDVQRRLNVSLSRRQALSVTQKDQCRTGNPIDDC 73