BLASTX nr result
ID: Zingiber24_contig00038178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00038178 (216 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847099.1| hypothetical protein AMTR_s00017p00217930 [A... 44 1e-06 >ref|XP_006847099.1| hypothetical protein AMTR_s00017p00217930 [Amborella trichopoda] gi|548850128|gb|ERN08680.1| hypothetical protein AMTR_s00017p00217930 [Amborella trichopoda] Length = 157 Score = 43.5 bits (101), Expect(2) = 1e-06 Identities = 20/42 (47%), Positives = 29/42 (69%) Frame = -2 Query: 173 RGCSFGSPASGVILFDIGVALKRLAASAFDVSQECRPKVEEA 48 +G P SGVILFDIGV K+L+ S F+ +CRP+V+++ Sbjct: 105 KGIKVTDPDSGVILFDIGVVHKQLSFSLFEDPPDCRPEVKQS 146 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 216 LSYGALCGVVGWAQEGLFLWL 154 LSYG L GV G++QE LFLWL Sbjct: 82 LSYGELIGVAGFSQEELFLWL 102