BLASTX nr result
ID: Zingiber24_contig00038093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00038093 (453 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGV29474.1| putative NAC domain class transcription factor [T... 59 9e-07 gb|EPS63856.1| hypothetical protein M569_10928 [Genlisea aurea] 58 1e-06 ref|XP_002456762.1| hypothetical protein SORBIDRAFT_03g042210 [S... 57 3e-06 >gb|AGV29474.1| putative NAC domain class transcription factor [Tamarix hispida] Length = 288 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -3 Query: 451 WIMNEYRLPQTEMTNC-KTEISICRVYKRAGVIENHRHRPPATLTASVPK 305 WIMNEYRLPQ E K EIS+CRVYKRAGV ++H H P + ++S+P+ Sbjct: 181 WIMNEYRLPQHETERLQKVEISLCRVYKRAGVEDHHHHNHPNS-SSSLPR 229 >gb|EPS63856.1| hypothetical protein M569_10928 [Genlisea aurea] Length = 284 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = -3 Query: 451 WIMNEYRLPQTEMTNCKTEISICRVYKRAGVIENHRHRPPATLTASVPKPSTPH 290 WIMNEYRLPQ + KTE S+CRVYKR GV ++ PA +A PKP+ P+ Sbjct: 132 WIMNEYRLPQNDTH--KTETSLCRVYKRTGVADSF----PAKSSAKTPKPTAPY 179 >ref|XP_002456762.1| hypothetical protein SORBIDRAFT_03g042210 [Sorghum bicolor] gi|241928737|gb|EES01882.1| hypothetical protein SORBIDRAFT_03g042210 [Sorghum bicolor] Length = 442 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 1/49 (2%) Frame = -3 Query: 451 WIMNEYRLPQTEMTNC-KTEISICRVYKRAGVIENHRHRPPATLTASVP 308 WIMNEYRLPQ KTEIS+CRVYKR G+ + H H PAT ++ P Sbjct: 162 WIMNEYRLPQDHTDRYHKTEISLCRVYKRTGIDDGHGHH-PATARSTTP 209