BLASTX nr result
ID: Zingiber24_contig00037601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00037601 (222 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGY49283.1| chloroplast terpene synthase [Hedychium coronarium] 69 5e-10 >gb|AGY49283.1| chloroplast terpene synthase [Hedychium coronarium] Length = 591 Score = 69.3 bits (168), Expect = 5e-10 Identities = 36/65 (55%), Positives = 39/65 (60%) Frame = -1 Query: 195 MSRYLVAPSYIPFHPKLCALRRSTNTTTEKPCSPLIHCTADMQSPALRRSSTHYQPNSWS 16 MS L PSY PF LRRST + PC L+ CTAD QSP R S HYQPN WS Sbjct: 1 MSLLLAPPSYFPFR----GLRRST-AAKQPPCLRLVKCTADRQSPEAARRSAHYQPNMWS 55 Query: 15 NDYIQ 1 +DYIQ Sbjct: 56 DDYIQ 60