BLASTX nr result
ID: Zingiber24_contig00037507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00037507 (207 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004958229.1| PREDICTED: LRR receptor-like serine/threonin... 64 2e-08 tpg|DAA63504.1| TPA: putative leucine-rich repeat receptor-like ... 62 6e-08 ref|XP_002460974.1| hypothetical protein SORBIDRAFT_02g038600 [S... 62 6e-08 gb|EMT03810.1| LRR receptor-like serine/threonine-protein kinase... 59 5e-07 gb|EMS55874.1| LRR receptor-like serine/threonine-protein kinase... 59 5e-07 ref|XP_003559991.1| PREDICTED: LRR receptor-like serine/threonin... 59 5e-07 dbj|BAK03469.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 5e-07 gb|EAY91907.1| hypothetical protein OsI_13592 [Oryza sativa Indi... 58 1e-06 ref|NP_001051315.1| Os03g0756200 [Oryza sativa Japonica Group] g... 58 1e-06 dbj|BAK01468.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 3e-06 ref|XP_004981723.1| PREDICTED: LRR receptor-like serine/threonin... 56 6e-06 ref|NP_001060207.1| Os07g0602700 [Oryza sativa Japonica Group] g... 56 6e-06 ref|XP_003559342.1| PREDICTED: LRR receptor-like serine/threonin... 56 6e-06 ref|XP_002463860.1| hypothetical protein SORBIDRAFT_01g007680 [S... 56 6e-06 gb|EAZ40566.1| hypothetical protein OsJ_25024 [Oryza sativa Japo... 56 6e-06 gb|EAZ04623.1| hypothetical protein OsI_26771 [Oryza sativa Indi... 56 6e-06 gb|AAM47583.1| putative protein kinase [Sorghum bicolor] 56 6e-06 ref|XP_006658775.1| PREDICTED: LRR receptor-like serine/threonin... 55 7e-06 gb|EMS50838.1| LRR receptor-like serine/threonine-protein kinase... 55 1e-05 >ref|XP_004958229.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase RPK2-like [Setaria italica] Length = 1080 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 +IYTRKCAP R S RSSGRKEVT+F +IGVP+TYE+V RAT Sbjct: 756 FIYTRKCAP--RMSARSSGRKEVTIFQDIGVPITYETVVRAT 795 >tpg|DAA63504.1| TPA: putative leucine-rich repeat receptor-like protein kinase family protein [Zea mays] Length = 1064 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 +IYTRKCAP R S RSSGR+EVT+F +IGVP+TYE+V RAT Sbjct: 740 FIYTRKCAP--RMSARSSGRREVTLFQDIGVPITYETVVRAT 779 >ref|XP_002460974.1| hypothetical protein SORBIDRAFT_02g038600 [Sorghum bicolor] gi|241924351|gb|EER97495.1| hypothetical protein SORBIDRAFT_02g038600 [Sorghum bicolor] Length = 1082 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 +IYTRKCAP R S RSSGR+EVT+F +IGVP+TYE+V RAT Sbjct: 758 FIYTRKCAP--RMSARSSGRREVTLFQDIGVPITYETVVRAT 797 >gb|EMT03810.1| LRR receptor-like serine/threonine-protein kinase RPK2 [Aegilops tauschii] Length = 890 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 +IYTRKCAP S RSSGR+EV +F EIGVP+TYE+V RAT Sbjct: 566 FIYTRKCAPF--MSARSSGRREVIIFQEIGVPITYETVVRAT 605 >gb|EMS55874.1| LRR receptor-like serine/threonine-protein kinase RPK2 [Triticum urartu] Length = 814 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 +IYTRKCAP S RSSGR+EV +F EIGVP+TYE+V RAT Sbjct: 490 FIYTRKCAPF--MSARSSGRREVIIFQEIGVPITYETVVRAT 529 >ref|XP_003559991.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase RPK2-like [Brachypodium distachyon] Length = 1168 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 ++YTRKCAP R + RSSGR+EV +F EIGVP+TYE+V RAT Sbjct: 844 FVYTRKCAP--RMAGRSSGRREVIIFQEIGVPITYETVVRAT 883 >dbj|BAK03469.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 1106 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 +IYTRKCAP S RSSGR+EV +F EIGVP+TYE+V RAT Sbjct: 782 FIYTRKCAPF--MSARSSGRREVIIFQEIGVPITYETVVRAT 821 >gb|EAY91907.1| hypothetical protein OsI_13592 [Oryza sativa Indica Group] gi|125587966|gb|EAZ28630.1| hypothetical protein OsJ_12640 [Oryza sativa Japonica Group] Length = 1010 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 YIYTRKCA +R S RS R+EVTVFV+IG PLTYE+V RAT Sbjct: 728 YIYTRKCA--SRQSRRSIRRREVTVFVDIGAPLTYETVVRAT 767 >ref|NP_001051315.1| Os03g0756200 [Oryza sativa Japonica Group] gi|37718809|gb|AAR01680.1| putative receptor-like protein kinase (having alternative splicing) [Oryza sativa Japonica Group] gi|108711157|gb|ABF98952.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica Group] gi|108711158|gb|ABF98953.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica Group] gi|113549786|dbj|BAF13229.1| Os03g0756200 [Oryza sativa Japonica Group] Length = 1049 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 YIYTRKCA +R S RS R+EVTVFV+IG PLTYE+V RAT Sbjct: 728 YIYTRKCA--SRQSRRSIRRREVTVFVDIGAPLTYETVVRAT 767 >dbj|BAK01468.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 1027 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARA 202 YIYTRKCA +R S RS+ R+EVTVFV+IG PLTYE+V RA Sbjct: 706 YIYTRKCA--SRPSRRSNRRREVTVFVDIGAPLTYETVVRA 744 >ref|XP_004981723.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase RPK2-like isoform X1 [Setaria italica] Length = 1062 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 YIYTRKCA +R S RS R+EVTVFV+IG PLTYE+V RA+ Sbjct: 741 YIYTRKCA--SRPSRRSLRRREVTVFVDIGAPLTYETVLRAS 780 >ref|NP_001060207.1| Os07g0602700 [Oryza sativa Japonica Group] gi|34394917|dbj|BAC84469.1| putative receptor-like protein kinase [Oryza sativa Japonica Group] gi|50509673|dbj|BAD31710.1| putative receptor-like protein kinase [Oryza sativa Japonica Group] gi|113611743|dbj|BAF22121.1| Os07g0602700 [Oryza sativa Japonica Group] gi|215712264|dbj|BAG94391.1| unnamed protein product [Oryza sativa Japonica Group] Length = 1084 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 +IYTRKCAP R S RSS R+EV F +IGVP+TYE+V RAT Sbjct: 760 FIYTRKCAP--RMSSRSSRRREVITFQDIGVPITYETVVRAT 799 >ref|XP_003559342.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase RPK2-like [Brachypodium distachyon] Length = 1037 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARA 202 YIYTRKCA +R S RS R+EVTVFV+IG PLTYE+V RA Sbjct: 716 YIYTRKCA--SRPSRRSLRRREVTVFVDIGAPLTYETVVRA 754 >ref|XP_002463860.1| hypothetical protein SORBIDRAFT_01g007680 [Sorghum bicolor] gi|241917714|gb|EER90858.1| hypothetical protein SORBIDRAFT_01g007680 [Sorghum bicolor] Length = 1063 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 YIYTRKCA +R S RS R+EVTVFV+IG PLTYE+V RA+ Sbjct: 742 YIYTRKCA--SRPSRRSLRRREVTVFVDIGAPLTYETVLRAS 781 >gb|EAZ40566.1| hypothetical protein OsJ_25024 [Oryza sativa Japonica Group] Length = 1070 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 +IYTRKCAP R S RSS R+EV F +IGVP+TYE+V RAT Sbjct: 746 FIYTRKCAP--RMSSRSSRRREVITFQDIGVPITYETVVRAT 785 >gb|EAZ04623.1| hypothetical protein OsI_26771 [Oryza sativa Indica Group] Length = 997 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 +IYTRKCAP R S RSS R+EV F +IGVP+TYE+V RAT Sbjct: 673 FIYTRKCAP--RMSSRSSRRREVITFQDIGVPITYETVVRAT 712 >gb|AAM47583.1| putative protein kinase [Sorghum bicolor] Length = 1053 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 YIYTRKCA +R S RS R+EVTVFV+IG PLTYE+V RA+ Sbjct: 612 YIYTRKCA--SRPSRRSLRRREVTVFVDIGAPLTYETVLRAS 651 >ref|XP_006658775.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase RPK2-like, partial [Oryza brachyantha] Length = 935 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARAT 205 +IYTRKCAP R S RSS R+EV F +IGVP+TYE+V RAT Sbjct: 611 FIYTRKCAP--RMSGRSSRRREVITFQDIGVPITYETVVRAT 650 >gb|EMS50838.1| LRR receptor-like serine/threonine-protein kinase RPK2 [Triticum urartu] Length = 1167 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 80 YIYTRKCAPSNRSSVRSSGRKEVTVFVEIGVPLTYESVARA 202 YIYTRKCA +R S R + R+EVTVFV+IG PLTYE+V RA Sbjct: 846 YIYTRKCA--SRPSRRPNRRREVTVFVDIGAPLTYETVVRA 884