BLASTX nr result
ID: Zingiber24_contig00037348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00037348 (326 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004308674.1| PREDICTED: probable pectinesterase/pectinest... 58 2e-06 >ref|XP_004308674.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25-like, partial [Fragaria vesca subsp. vesca] Length = 522 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/56 (44%), Positives = 38/56 (67%) Frame = -3 Query: 258 LVAFCFLHLAAGEATSPAVSRASACKSSFYPKLCLALLWPLRRTPSNQYEYGKYSV 91 L+ FCF A + P+ S ++ACKS+ YPKLC ++L +R +PS+ Y YGK+S+ Sbjct: 19 LLIFCFPAEAESPPSPPSSSASAACKSTLYPKLCRSILSAIRSSPSDPYNYGKFSI 74