BLASTX nr result
ID: Zingiber24_contig00037326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00037326 (243 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC00238.1| hypothetical protein L484_010345 [Morus notabilis] 60 2e-07 >gb|EXC00238.1| hypothetical protein L484_010345 [Morus notabilis] Length = 304 Score = 60.5 bits (145), Expect = 2e-07 Identities = 35/81 (43%), Positives = 45/81 (55%), Gaps = 2/81 (2%) Frame = +3 Query: 3 EEEAEEDVGSPSGSSERRCKRALEREGNE--IRELARAIERFSDIYENVEVAXXXXXXXX 176 EEEAE++ SGS R + E RELA+AIERF +IY+ VEVA Sbjct: 197 EEEAEDEESDRSGSRSSMKSRGRDEREREPMYRELAKAIERFGEIYQRVEVAKQRQMVEL 256 Query: 177 XXXXXXFDKELEFQRMQMFVD 239 F K+LEFQRMQ+F++ Sbjct: 257 EKQRMQFAKDLEFQRMQLFME 277