BLASTX nr result
ID: Zingiber24_contig00037164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00037164 (444 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65988.1| hypothetical protein VITISV_042145 [Vitis vinifera] 86 4e-15 emb|CBI39039.3| unnamed protein product [Vitis vinifera] 79 8e-13 ref|NP_085513.1| hypothetical protein ArthMp046 [Arabidopsis tha... 70 4e-10 dbj|BAF01764.1| hypothetical protein [Arabidopsis thaliana] 68 1e-09 gb|AEX57688.1| hypothetical protein RasatMp057 (mitochondrion) [... 66 5e-09 ref|YP_717126.1| hypothetical protein BrnapMp028 [Brassica napus... 66 5e-09 >emb|CAN65988.1| hypothetical protein VITISV_042145 [Vitis vinifera] Length = 150 Score = 86.3 bits (212), Expect = 4e-15 Identities = 60/135 (44%), Positives = 72/135 (53%), Gaps = 4/135 (2%) Frame = +1 Query: 1 FLLRLILGGVFRGLK*KFFA----AHSALILIHVAIARTFLFRVDLPPTPRNRSSEAGVT 168 F LRLI G + G++ FF +H L+L+ + R DLPPTPRNRSS Sbjct: 19 FFLRLIRGLLLWGIQFLFFLLLLISHRELLLL----VQGHQMR-DLPPTPRNRSSGR--- 70 Query: 169 NEKNNVSIVSERDEDFLIEES*GLDSPLSL*KPLH*GEQKRKDEYVLDSRIHSRPDPPWN 348 ++SI KPL GEQK +DEYVLDSRIHSRPDPPWN Sbjct: 71 LPSTHLSIYK---------------------KPLPRGEQKLQDEYVLDSRIHSRPDPPWN 109 Query: 349 LRNLLKHYRRGLVLL 393 RNL KH RRG V++ Sbjct: 110 FRNLPKHSRRGFVMI 124 >emb|CBI39039.3| unnamed protein product [Vitis vinifera] Length = 199 Score = 78.6 bits (192), Expect = 8e-13 Identities = 46/91 (50%), Positives = 51/91 (56%) Frame = +1 Query: 121 DLPPTPRNRSSEAGVTNEKNNVSIVSERDEDFLIEES*GLDSPLSL*KPLH*GEQKRKDE 300 DLPPTPRNRSS ++SI KPL GEQK +DE Sbjct: 126 DLPPTPRNRSSGR---LPSTHLSIYK---------------------KPLSRGEQKLQDE 161 Query: 301 YVLDSRIHSRPDPPWNLRNLLKHYRRGLVLL 393 YVLDSRIHSRPDPPWN NL KH RRG V++ Sbjct: 162 YVLDSRIHSRPDPPWNFWNLPKHSRRGFVMI 192 >ref|NP_085513.1| hypothetical protein ArthMp046 [Arabidopsis thaliana] gi|42570727|ref|NP_973437.1| uncharacterized protein [Arabidopsis thaliana] gi|44888124|sp|P93308.1|M530_ARATH RecName: Full=Uncharacterized mitochondrial protein AtMg00530; AltName: Full=ORF109 gi|1785714|emb|CAA69737.1| unnamed protein product [Arabidopsis thaliana] gi|330250966|gb|AEC06060.1| uncharacterized protein AT2G07776 [Arabidopsis thaliana] Length = 109 Score = 69.7 bits (169), Expect = 4e-10 Identities = 43/97 (44%), Positives = 52/97 (53%), Gaps = 6/97 (6%) Frame = +1 Query: 121 DLPPTPRNRSSE------AGVTNEKNNVSIVSERDEDFLIEES*GLDSPLSL*KPLH*GE 282 DL PTPRNRS+ + V N ++SI K L GE Sbjct: 27 DLLPTPRNRSNGRLPSPFSRVINPSTHLSIHK---------------------KALPRGE 65 Query: 283 QKRKDEYVLDSRIHSRPDPPWNLRNLLKHYRRGLVLL 393 +K +DEY LDSRIHSRPDP WN RNL KH R+GLV++ Sbjct: 66 RKLQDEYALDSRIHSRPDPLWNFRNLQKHSRKGLVMI 102 >dbj|BAF01764.1| hypothetical protein [Arabidopsis thaliana] Length = 109 Score = 67.8 bits (164), Expect = 1e-09 Identities = 42/97 (43%), Positives = 51/97 (52%), Gaps = 6/97 (6%) Frame = +1 Query: 121 DLPPTPRNRSSE------AGVTNEKNNVSIVSERDEDFLIEES*GLDSPLSL*KPLH*GE 282 DL PTPRNRS+ + V N ++ I K L GE Sbjct: 27 DLLPTPRNRSNGRLPSPFSRVINPSTHLPIHK---------------------KALPRGE 65 Query: 283 QKRKDEYVLDSRIHSRPDPPWNLRNLLKHYRRGLVLL 393 +K +DEY LDSRIHSRPDP WN RNL KH R+GLV++ Sbjct: 66 RKLQDEYALDSRIHSRPDPLWNFRNLQKHSRKGLVMI 102 >gb|AEX57688.1| hypothetical protein RasatMp057 (mitochondrion) [Raphanus sativus] gi|443298178|gb|AGC81722.1| hypothetical protein DCGMS_00620 (mitochondrion) [Raphanus sativus] Length = 159 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 262 KPLH*GEQKRKDEYVLDSRIHSRPDPPWNLRNLLKHYRRGLVLL 393 K L GE+K +DEY LDSRIHSRPDP WN RNL KH R+GLV++ Sbjct: 109 KALPRGERKLQDEYALDSRIHSRPDPLWNFRNLQKHSRKGLVMI 152 >ref|YP_717126.1| hypothetical protein BrnapMp028 [Brassica napus] gi|353526373|ref|YP_004927448.1| orf159 (mitochondrion) [Brassica oleracea] gi|353526526|ref|YP_004927596.1| orf159 (mitochondrion) [Brassica carinata] gi|353526717|ref|YP_004927888.1| orf159 (mitochondrion) [Brassica rapa subsp. oleifera] gi|353531399|ref|YP_004927791.1| orf159 (mitochondrion) [Brassica juncea] gi|37591072|dbj|BAC98874.1| hypothetical protein [Brassica napus] gi|335354905|gb|AEH43461.1| orf159 [Brassica rapa subsp. oleifera] gi|335354918|gb|AEH43473.1| orf159 [Brassica oleracea] gi|335355057|gb|AEH43611.1| orf159 [Brassica carinata] gi|335355132|gb|AEH43685.1| orf159 [Brassica juncea] gi|339511333|emb|CBX48388.1| unnamed protein product [Brassica napus] Length = 159 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 262 KPLH*GEQKRKDEYVLDSRIHSRPDPPWNLRNLLKHYRRGLVLL 393 K L GE+K +DEY LDSRIHSRPDP WN RNL KH R+GLV++ Sbjct: 109 KALPRGERKLQDEYALDSRIHSRPDPLWNFRNLQKHSRKGLVMI 152