BLASTX nr result
ID: Zingiber24_contig00036979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00036979 (269 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_588284.1| hypothetical protein ZeamMp020 [Zea mays subsp.... 47 6e-08 >ref|YP_588284.1| hypothetical protein ZeamMp020 [Zea mays subsp. mays] gi|94502700|ref|YP_588308.1| hypothetical protein ZeamMp046 [Zea mays subsp. mays] gi|40795138|gb|AAR91182.1| hypothetical protein (mitochondrion) [Zea mays] gi|40795139|gb|AAR91183.1| hypothetical protein (mitochondrion) [Zea mays] Length = 99 Score = 47.0 bits (110), Expect(2) = 6e-08 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = -3 Query: 189 GIRSKLAFLFDHFDRGGWIKWTKKGDGFQSKRWV 88 G + L LF HF RGGWIKW K+ FQSKRWV Sbjct: 7 GNKKHLKCLFYHFYRGGWIKWAKQTHIFQSKRWV 40 Score = 35.4 bits (80), Expect(2) = 6e-08 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -1 Query: 107 SSRKDGFSS*QRKKNLENALINPFVEPAVCIVSDP 3 S R FSS QRK +LENA NPFV P CIVSDP Sbjct: 36 SKRWVPFSSRQRKNHLENA-PNPFVGP--CIVSDP 67