BLASTX nr result
ID: Zingiber24_contig00036945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00036945 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006586939.1| PREDICTED: DDB1- and CUL4-associated factor ... 57 3e-06 ref|XP_004228334.1| PREDICTED: uncharacterized protein LOC101252... 57 3e-06 gb|EXB83247.1| DDB1- and CUL4-associated factor 4 [Morus notabilis] 56 4e-06 ref|XP_006341894.1| PREDICTED: DDB1- and CUL4-associated factor ... 56 4e-06 ref|XP_006597751.1| PREDICTED: DDB1- and CUL4-associated factor ... 55 1e-05 >ref|XP_006586939.1| PREDICTED: DDB1- and CUL4-associated factor 4-like [Glycine max] Length = 514 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +3 Query: 135 MTLPKDIPGFYYDSEKNRYFPTKGPIPG 218 M PKD+PGFYYDSEK+RYFP KGPIPG Sbjct: 1 MPQPKDLPGFYYDSEKSRYFPIKGPIPG 28 >ref|XP_004228334.1| PREDICTED: uncharacterized protein LOC101252105 [Solanum lycopersicum] Length = 496 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/58 (43%), Positives = 31/58 (53%) Frame = +3 Query: 141 LPKDIPGFYYDSEKNRYFPTKGPIPGXXXXXXXXXXXXXXXXXXNGKLSSPDQDYLIH 314 +PK++PGFYYD+EKNRYFP KGPIPG GK + L+H Sbjct: 1 MPKELPGFYYDAEKNRYFPIKGPIPGSSKKRKSPSPIVSTKERDKGKCMKSGSNNLLH 58 >gb|EXB83247.1| DDB1- and CUL4-associated factor 4 [Morus notabilis] Length = 459 Score = 56.2 bits (134), Expect = 4e-06 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = +3 Query: 141 LPKDIPGFYYDSEKNRYFPTKGPIPG 218 +P+D+PGFYYD+EKNRYFP KGPIPG Sbjct: 1 MPRDLPGFYYDAEKNRYFPIKGPIPG 26 >ref|XP_006341894.1| PREDICTED: DDB1- and CUL4-associated factor 4-like [Solanum tuberosum] Length = 496 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/58 (43%), Positives = 31/58 (53%) Frame = +3 Query: 141 LPKDIPGFYYDSEKNRYFPTKGPIPGXXXXXXXXXXXXXXXXXXNGKLSSPDQDYLIH 314 +PK++PGFYYD+EKNRYFP KGPIPG GK + L+H Sbjct: 1 MPKELPGFYYDAEKNRYFPIKGPIPGSSKKRKSPSPIVSTKERDKGKCMKSRSNKLLH 58 >ref|XP_006597751.1| PREDICTED: DDB1- and CUL4-associated factor 4-like [Glycine max] Length = 514 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = +3 Query: 135 MTLPKDIPGFYYDSEKNRYFPTKGPIPG 218 M PK++PGFYYD EKNRYFP KGPIPG Sbjct: 1 MPQPKELPGFYYDPEKNRYFPIKGPIPG 28