BLASTX nr result
ID: Zingiber24_contig00035878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00035878 (234 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ24285.1| hypothetical protein PRUPE_ppa007000mg [Prunus pe... 64 2e-08 ref|XP_006416837.1| hypothetical protein EUTSA_v10007905mg [Eutr... 62 6e-08 ref|XP_006305067.1| hypothetical protein CARUB_v10009433mg [Caps... 62 6e-08 ref|XP_002890155.1| kelch repeat-containing F-box family protein... 62 6e-08 ref|NP_173075.3| F-box/kelch-repeat protein [Arabidopsis thalian... 62 6e-08 ref|XP_002315479.2| kelch repeat-containing F-box family protein... 60 3e-07 ref|XP_006353737.1| PREDICTED: F-box/kelch-repeat protein At1g16... 60 4e-07 ref|XP_004243661.1| PREDICTED: F-box/kelch-repeat protein At1g16... 60 4e-07 ref|XP_006353736.1| PREDICTED: F-box/kelch-repeat protein At1g16... 59 5e-07 ref|XP_004297025.1| PREDICTED: F-box/kelch-repeat protein At1g16... 58 2e-06 ref|XP_002519349.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 gb|EOY10559.1| Galactose oxidase/kelch repeat superfamily protei... 56 4e-06 gb|ADE77005.1| unknown [Picea sitchensis] 55 7e-06 >gb|EMJ24285.1| hypothetical protein PRUPE_ppa007000mg [Prunus persica] Length = 386 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +3 Query: 123 VDEMSESIIPGLPNDLALRCLAMISHGYHGLLECVSK 233 ++ + +SIIPGLP+DLALRCLAM+SHGYHGLLE VSK Sbjct: 1 MESVHQSIIPGLPDDLALRCLAMVSHGYHGLLETVSK 37 >ref|XP_006416837.1| hypothetical protein EUTSA_v10007905mg [Eutrema salsugineum] gi|557094608|gb|ESQ35190.1| hypothetical protein EUTSA_v10007905mg [Eutrema salsugineum] Length = 383 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +3 Query: 123 VDEMSESIIPGLPNDLALRCLAMISHGYHGLLECVSK 233 ++ + +SIIPGLP+DLALRCLA +SHGYHG LECVS+ Sbjct: 1 MESIEQSIIPGLPDDLALRCLAKLSHGYHGALECVSR 37 >ref|XP_006305067.1| hypothetical protein CARUB_v10009433mg [Capsella rubella] gi|482573778|gb|EOA37965.1| hypothetical protein CARUB_v10009433mg [Capsella rubella] Length = 383 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 132 MSESIIPGLPNDLALRCLAMISHGYHGLLECVSK 233 + +SIIPGLP+DLALRC+A +SHGYHGLLECVS+ Sbjct: 4 IEQSIIPGLPDDLALRCIAKLSHGYHGLLECVSR 37 >ref|XP_002890155.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297335997|gb|EFH66414.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata subsp. lyrata] Length = 404 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/37 (67%), Positives = 34/37 (91%) Frame = +3 Query: 123 VDEMSESIIPGLPNDLALRCLAMISHGYHGLLECVSK 233 ++ + +SIIPGLP+DLALRC+A +SHGYHG+LECVS+ Sbjct: 22 MESIEQSIIPGLPDDLALRCIAKLSHGYHGVLECVSR 58 >ref|NP_173075.3| F-box/kelch-repeat protein [Arabidopsis thaliana] gi|122242689|sp|Q0WW40.1|FBK5_ARATH RecName: Full=F-box/kelch-repeat protein At1g16250 gi|110741130|dbj|BAE98658.1| hypothetical protein [Arabidopsis thaliana] gi|119360151|gb|ABL66804.1| At1g16250 [Arabidopsis thaliana] gi|332191305|gb|AEE29426.1| F-box/kelch-repeat protein [Arabidopsis thaliana] Length = 383 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/37 (67%), Positives = 34/37 (91%) Frame = +3 Query: 123 VDEMSESIIPGLPNDLALRCLAMISHGYHGLLECVSK 233 ++ + +SIIPGLP+DLALRC+A +SHGYHG+LECVS+ Sbjct: 1 MESIEQSIIPGLPDDLALRCIAKLSHGYHGVLECVSR 37 >ref|XP_002315479.2| kelch repeat-containing F-box family protein [Populus trichocarpa] gi|550328820|gb|EEF01650.2| kelch repeat-containing F-box family protein [Populus trichocarpa] Length = 383 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 132 MSESIIPGLPNDLALRCLAMISHGYHGLLECVSK 233 M + IIPGLP+DLALRCLA +SHGYHGLLE VSK Sbjct: 1 MHQPIIPGLPDDLALRCLAKVSHGYHGLLESVSK 34 >ref|XP_006353737.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like isoform X2 [Solanum tuberosum] Length = 382 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +3 Query: 123 VDEMSESIIPGLPNDLALRCLAMISHGYHGLLECVSK 233 ++ + + +IPGLP+DLALRCLAMISHGYHG+LE VS+ Sbjct: 1 METIDQPLIPGLPDDLALRCLAMISHGYHGILETVSR 37 >ref|XP_004243661.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like [Solanum lycopersicum] Length = 382 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +3 Query: 123 VDEMSESIIPGLPNDLALRCLAMISHGYHGLLECVSK 233 ++ + + +IPGLP+DLALRCLAMISHGYHG+LE VS+ Sbjct: 1 METIDQPLIPGLPDDLALRCLAMISHGYHGILETVSR 37 >ref|XP_006353736.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like isoform X1 [Solanum tuberosum] Length = 396 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +3 Query: 126 DEMSESIIPGLPNDLALRCLAMISHGYHGLLECVSK 233 + + + +IPGLP+DLALRCLAMISHGYHG+LE VS+ Sbjct: 16 ETIDQPLIPGLPDDLALRCLAMISHGYHGILETVSR 51 >ref|XP_004297025.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like [Fragaria vesca subsp. vesca] Length = 379 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = +3 Query: 123 VDEMSESIIPGLPNDLALRCLAMISHGYHGLLECVSK 233 ++ + ++IIPGLP+DLALRCL +SHGYHGL+E VSK Sbjct: 1 MESLHQAIIPGLPDDLALRCLTKLSHGYHGLVETVSK 37 >ref|XP_002519349.1| conserved hypothetical protein [Ricinus communis] gi|223541664|gb|EEF43213.1| conserved hypothetical protein [Ricinus communis] Length = 388 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +3 Query: 126 DEMSESIIPGLPNDLALRCLAMISHGYHGLLECVSK 233 + + + IIPGLP+DLALRCLA +SHG+HGLLE VSK Sbjct: 7 ESIHQPIIPGLPDDLALRCLAKLSHGHHGLLETVSK 42 >gb|EOY10559.1| Galactose oxidase/kelch repeat superfamily protein [Theobroma cacao] Length = 382 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = +3 Query: 123 VDEMSESIIPGLPNDLALRCLAMISHGYHGLLECVSK 233 ++ + E+I+PGLP+DLALRCLA +SHGY G+LE VSK Sbjct: 1 MEPVKEAILPGLPDDLALRCLAKLSHGYDGVLEAVSK 37 >gb|ADE77005.1| unknown [Picea sitchensis] Length = 389 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 141 SIIPGLPNDLALRCLAMISHGYHGLLECVSK 233 +IIPGLP+DLAL+CLA +SHGYHGLLE V K Sbjct: 16 AIIPGLPDDLALKCLAKVSHGYHGLLEVVCK 46