BLASTX nr result
ID: Zingiber24_contig00035698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00035698 (478 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ21845.1| hypothetical protein PRUPE_ppa003474mg [Prunus pe... 58 2e-06 >gb|EMJ21845.1| hypothetical protein PRUPE_ppa003474mg [Prunus persica] Length = 572 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/66 (40%), Positives = 41/66 (62%) Frame = -1 Query: 322 ALLFVVCSVIPLXXXXXXXXXXACRSSFYPKLCVAMLSPLRSRTSSQYEYGKYSVRQALR 143 +LL+ ++P AC+S+ YPKLC ++LS +RS S Y YGK+S++Q L+ Sbjct: 13 SLLYNFSLLLPTSASSSSSASSACKSTLYPKLCRSILSTIRSSPSDPYNYGKFSIKQCLK 72 Query: 142 QVRRTS 125 Q R+TS Sbjct: 73 QARKTS 78