BLASTX nr result
ID: Zingiber24_contig00035560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00035560 (496 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB93328.1| hypothetical protein L484_015316 [Morus notabilis] 67 2e-09 ref|XP_002299927.1| hypothetical protein POPTR_0001s26960g [Popu... 66 4e-09 ref|XP_004307240.1| PREDICTED: uncharacterized protein LOC101299... 66 6e-09 ref|XP_002285363.1| PREDICTED: uncharacterized protein LOC100265... 66 6e-09 ref|XP_002274472.1| PREDICTED: uncharacterized protein LOC100255... 65 7e-09 ref|XP_002873579.1| hypothetical protein ARALYDRAFT_909228 [Arab... 65 9e-09 gb|EAY97895.1| hypothetical protein OsI_19813 [Oryza sativa Indi... 64 2e-08 ref|NP_001055430.1| Os05g0388600 [Oryza sativa Japonica Group] g... 64 2e-08 ref|NP_568280.1| uncharacterized protein [Arabidopsis thaliana] ... 64 2e-08 ref|XP_006399765.1| hypothetical protein EUTSA_v10013804mg [Eutr... 64 2e-08 dbj|BAD44296.1| unknown protein [Arabidopsis thaliana] 64 2e-08 gb|ESW03398.1| hypothetical protein PHAVU_011G011000g [Phaseolus... 64 3e-08 ref|XP_002513515.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 gb|AFW77857.1| hypothetical protein ZEAMMB73_229307 [Zea mays] 63 4e-08 ref|XP_002517765.1| conserved hypothetical protein [Ricinus comm... 63 4e-08 ref|NP_001143763.1| uncharacterized protein LOC100276525 [Zea ma... 63 4e-08 ref|XP_006654349.1| PREDICTED: uncharacterized protein LOC102713... 63 5e-08 ref|XP_006286727.1| hypothetical protein CARUB_v10002952mg [Caps... 63 5e-08 gb|EMJ19332.1| hypothetical protein PRUPE_ppa007145mg [Prunus pe... 62 6e-08 ref|XP_006438954.1| hypothetical protein CICLE_v10031842mg [Citr... 62 8e-08 >gb|EXB93328.1| hypothetical protein L484_015316 [Morus notabilis] Length = 392 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLAAAIE GRIPGL+V R+ ELE+SS+FRWL+QFGG Sbjct: 126 PKDLAAAIEAGRIPGLVVTRYFELEKSSLFRWLMQFGG 163 >ref|XP_002299927.1| hypothetical protein POPTR_0001s26960g [Populus trichocarpa] gi|222847185|gb|EEE84732.1| hypothetical protein POPTR_0001s26960g [Populus trichocarpa] Length = 382 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLAAAIE GR+PG IV R+ ELE+S+VFRWLLQFGG Sbjct: 115 PKDLAAAIEAGRVPGSIVSRYFELEKSAVFRWLLQFGG 152 >ref|XP_004307240.1| PREDICTED: uncharacterized protein LOC101299328 [Fragaria vesca subsp. vesca] Length = 277 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLAAA+E GR+PGLIV+RF ELE+S +FRWLLQF G Sbjct: 14 PKDLAAAVEAGRVPGLIVKRFFELEKSPIFRWLLQFDG 51 >ref|XP_002285363.1| PREDICTED: uncharacterized protein LOC100265633 [Vitis vinifera] Length = 384 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLAAAIE+G+IP IV+++LELE+S+VFRWLLQFGG Sbjct: 114 PKDLAAAIESGKIPAAIVEKYLELEKSAVFRWLLQFGG 151 >ref|XP_002274472.1| PREDICTED: uncharacterized protein LOC100255131 [Vitis vinifera] Length = 380 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLAAA++ GRIPG IV R+ ELE+S+VFRWLLQFGG Sbjct: 113 PKDLAAAVQAGRIPGAIVSRYFELEKSAVFRWLLQFGG 150 >ref|XP_002873579.1| hypothetical protein ARALYDRAFT_909228 [Arabidopsis lyrata subsp. lyrata] gi|297319416|gb|EFH49838.1| hypothetical protein ARALYDRAFT_909228 [Arabidopsis lyrata subsp. lyrata] Length = 385 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLAAAIE+GRIPG ++ RFLEL++S+V RWL+QFGG Sbjct: 119 PKDLAAAIESGRIPGSVITRFLELQKSAVMRWLMQFGG 156 >gb|EAY97895.1| hypothetical protein OsI_19813 [Oryza sativa Indica Group] Length = 297 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 P DLAAAIE GR+PG IVQRF +LE+S +FRWLLQFGG Sbjct: 34 PADLAAAIEGGRVPGEIVQRFADLEKSGLFRWLLQFGG 71 >ref|NP_001055430.1| Os05g0388600 [Oryza sativa Japonica Group] gi|54287600|gb|AAV31344.1| unknown protein [Oryza sativa Japonica Group] gi|113578981|dbj|BAF17344.1| Os05g0388600 [Oryza sativa Japonica Group] gi|215740932|dbj|BAG97427.1| unnamed protein product [Oryza sativa Japonica Group] gi|222631454|gb|EEE63586.1| hypothetical protein OsJ_18403 [Oryza sativa Japonica Group] Length = 378 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 P DLAAAIE GR+PG IVQRF +LE+S +FRWLLQFGG Sbjct: 115 PADLAAAIEGGRVPGEIVQRFADLEKSGLFRWLLQFGG 152 >ref|NP_568280.1| uncharacterized protein [Arabidopsis thaliana] gi|14586377|emb|CAC42908.1| putative protein [Arabidopsis thaliana] gi|20268752|gb|AAM14079.1| unknown protein [Arabidopsis thaliana] gi|21281149|gb|AAM45049.1| unknown protein [Arabidopsis thaliana] gi|27311697|gb|AAO00814.1| putative protein [Arabidopsis thaliana] gi|30725614|gb|AAP37829.1| At5g12470 [Arabidopsis thaliana] gi|51970560|dbj|BAD43972.1| unknown protein [Arabidopsis thaliana] gi|332004431|gb|AED91814.1| uncharacterized protein AT5G12470 [Arabidopsis thaliana] Length = 386 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLAAAIE GRIPG ++ RFLEL++S+V RWL+QFGG Sbjct: 120 PKDLAAAIEAGRIPGSVITRFLELQKSAVMRWLMQFGG 157 >ref|XP_006399765.1| hypothetical protein EUTSA_v10013804mg [Eutrema salsugineum] gi|557100855|gb|ESQ41218.1| hypothetical protein EUTSA_v10013804mg [Eutrema salsugineum] Length = 383 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLAAAIE+GRIPG ++ RFLEL+RS+V RWL+QF G Sbjct: 117 PKDLAAAIESGRIPGSVITRFLELQRSAVMRWLMQFAG 154 >dbj|BAD44296.1| unknown protein [Arabidopsis thaliana] Length = 386 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLAAAIE GRIPG ++ RFLEL++S+V RWL+QFGG Sbjct: 120 PKDLAAAIEAGRIPGSVITRFLELQKSAVMRWLMQFGG 157 >gb|ESW03398.1| hypothetical protein PHAVU_011G011000g [Phaseolus vulgaris] Length = 378 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 P DLAAA+E GR+PG I++RFLELE+S+VFRWLL FGG Sbjct: 107 PADLAAAVEAGRVPGSILKRFLELEKSAVFRWLLNFGG 144 >ref|XP_002513515.1| conserved hypothetical protein [Ricinus communis] gi|223547423|gb|EEF48918.1| conserved hypothetical protein [Ricinus communis] Length = 392 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLAAAI+ GRIPG +V RFL LE S +FRWLLQFGG Sbjct: 119 PKDLAAAIQAGRIPGAVVSRFLALENSGLFRWLLQFGG 156 >gb|AFW77857.1| hypothetical protein ZEAMMB73_229307 [Zea mays] Length = 387 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 P DLAAA+E GRIPG IV+RF++LE S VFRWLLQFGG Sbjct: 124 PADLAAAVEGGRIPGEIVRRFVDLEASPVFRWLLQFGG 161 >ref|XP_002517765.1| conserved hypothetical protein [Ricinus communis] gi|223543037|gb|EEF44572.1| conserved hypothetical protein [Ricinus communis] Length = 388 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLA AIE GR+PG IV R+ ELE+S +FRWLLQFGG Sbjct: 121 PKDLAGAIEAGRLPGSIVHRYFELEKSPIFRWLLQFGG 158 >ref|NP_001143763.1| uncharacterized protein LOC100276525 [Zea mays] gi|195626500|gb|ACG35080.1| hypothetical protein [Zea mays] Length = 387 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 P DLAAA+E GRIPG IV+RF++LE S VFRWLLQFGG Sbjct: 124 PADLAAAVEGGRIPGEIVRRFVDLEASPVFRWLLQFGG 161 >ref|XP_006654349.1| PREDICTED: uncharacterized protein LOC102713740 [Oryza brachyantha] Length = 394 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 P DLA A+E GR+PG IVQRF +LE+S++FRWLLQFGG Sbjct: 131 PADLAVAVEGGRVPGEIVQRFADLEKSALFRWLLQFGG 168 >ref|XP_006286727.1| hypothetical protein CARUB_v10002952mg [Capsella rubella] gi|482555433|gb|EOA19625.1| hypothetical protein CARUB_v10002952mg [Capsella rubella] Length = 366 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLAAAIE+GRIPG ++ RFLEL++S+V RWL+QF G Sbjct: 118 PKDLAAAIESGRIPGSVITRFLELQKSAVMRWLMQFAG 155 >gb|EMJ19332.1| hypothetical protein PRUPE_ppa007145mg [Prunus persica] Length = 380 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLAAAIE GR+PG IV+RF ELE+S+VFRWLL F G Sbjct: 113 PKDLAAAIEAGRVPGSIVRRFFELEKSAVFRWLLGFDG 150 >ref|XP_006438954.1| hypothetical protein CICLE_v10031842mg [Citrus clementina] gi|557541150|gb|ESR52194.1| hypothetical protein CICLE_v10031842mg [Citrus clementina] Length = 282 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 382 PKDLAAAIENGRIPGLIVQRFLELERSSVFRWLLQFGG 495 PKDLA AIE GR+P IV+R+LELE+S VFRWLL FGG Sbjct: 111 PKDLAGAIEAGRVPAAIVKRYLELEKSPVFRWLLNFGG 148