BLASTX nr result
ID: Zingiber24_contig00035515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00035515 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY10814.1| Uncharacterized protein isoform 1 [Theobroma cacao] 57 3e-06 >gb|EOY10814.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 443 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = +3 Query: 153 FGVKGALASPGNRTARRGITSLRIARIQRHLARINKPAVRTIESPDGGDIN 305 F K L S N T R ++SLR+ RIQ+HLA+INKPAV TIESPDG I+ Sbjct: 33 FVTKFTLVSGLNYTKYRQVSSLRLERIQKHLAKINKPAVMTIESPDGDIID 83