BLASTX nr result
ID: Zingiber24_contig00035424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00035424 (256 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004970594.1| PREDICTED: heme-binding-like protein At3g101... 56 6e-06 ref|XP_002456642.1| hypothetical protein SORBIDRAFT_03g039990 [S... 56 6e-06 gb|EEC71815.1| hypothetical protein OsI_04454 [Oryza sativa Indi... 56 6e-06 ref|NP_001044817.1| Os01g0850900 [Oryza sativa Japonica Group] g... 56 6e-06 >ref|XP_004970594.1| PREDICTED: heme-binding-like protein At3g10130, chloroplastic-like [Setaria italica] Length = 221 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 156 MGLLLGKITVETPKYEVLHTCPDYEIRSYSPCV 254 MG++LGKITVETPK+EVLHT YEIR Y PCV Sbjct: 1 MGMVLGKITVETPKHEVLHTGAGYEIRRYPPCV 33 >ref|XP_002456642.1| hypothetical protein SORBIDRAFT_03g039990 [Sorghum bicolor] gi|241928617|gb|EES01762.1| hypothetical protein SORBIDRAFT_03g039990 [Sorghum bicolor] Length = 220 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 156 MGLLLGKITVETPKYEVLHTCPDYEIRSYSPCV 254 MG++LGKITVETPK+EVLHT YEIR Y PC+ Sbjct: 1 MGMVLGKITVETPKHEVLHTGAGYEIRKYPPCI 33 >gb|EEC71815.1| hypothetical protein OsI_04454 [Oryza sativa Indica Group] Length = 216 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 156 MGLLLGKITVETPKYEVLHTCPDYEIRSYSPCV 254 MG++LGKITVETPK+EVLHT YE+R Y PCV Sbjct: 1 MGMVLGKITVETPKHEVLHTGAGYEVRKYPPCV 33 >ref|NP_001044817.1| Os01g0850900 [Oryza sativa Japonica Group] gi|20805177|dbj|BAB92846.1| SOUL heme-binding protein-like [Oryza sativa Japonica Group] gi|113534348|dbj|BAF06731.1| Os01g0850900 [Oryza sativa Japonica Group] gi|215686624|dbj|BAG88877.1| unnamed protein product [Oryza sativa Japonica Group] gi|215736835|dbj|BAG95764.1| unnamed protein product [Oryza sativa Japonica Group] Length = 216 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 156 MGLLLGKITVETPKYEVLHTCPDYEIRSYSPCV 254 MG++LGKITVETPK+EVLHT YE+R Y PCV Sbjct: 1 MGMVLGKITVETPKHEVLHTGAGYEVRKYPPCV 33