BLASTX nr result
ID: Zingiber24_contig00035013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00035013 (1304 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citr... 59 4e-06 >ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] gi|557522886|gb|ESR34253.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] Length = 71 Score = 58.9 bits (141), Expect = 4e-06 Identities = 34/68 (50%), Positives = 40/68 (58%), Gaps = 10/68 (14%) Frame = -1 Query: 986 FFSYPGGGNGKQRDIAR*ASVGQ---------VT*CPTQLFQ*GNRP-AKLLSLQHVPTL 837 FFSYPGGGNGKQRDIA+ A + + + P LFQ N P LLS+ HVPT Sbjct: 4 FFSYPGGGNGKQRDIAQNAGIQKANIFDKRKSLNYFPVALFQERNEPVTMLLSMHHVPTF 63 Query: 836 ISKFRSSP 813 IS F + P Sbjct: 64 ISSFNNPP 71