BLASTX nr result
ID: Zingiber24_contig00034845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00034845 (566 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY33188.1| Spc97 / Spc98 family of spindle pole body compone... 55 9e-06 gb|EOY33186.1| Spc97 / Spc98 family of spindle pole body compone... 55 9e-06 >gb|EOY33188.1| Spc97 / Spc98 family of spindle pole body component, putative isoform 3 [Theobroma cacao] Length = 1233 Score = 55.5 bits (132), Expect = 9e-06 Identities = 21/33 (63%), Positives = 29/33 (87%) Frame = +1 Query: 466 MEIDTNFSTLLQSLKVDDPWIPPKTWESIPSES 564 M ++TNF++L LKV+DPW+PP+TWESIPS+S Sbjct: 1 MALETNFASLFGKLKVEDPWLPPRTWESIPSQS 33 >gb|EOY33186.1| Spc97 / Spc98 family of spindle pole body component, putative isoform 1 [Theobroma cacao] Length = 1238 Score = 55.5 bits (132), Expect = 9e-06 Identities = 21/33 (63%), Positives = 29/33 (87%) Frame = +1 Query: 466 MEIDTNFSTLLQSLKVDDPWIPPKTWESIPSES 564 M ++TNF++L LKV+DPW+PP+TWESIPS+S Sbjct: 1 MALETNFASLFGKLKVEDPWLPPRTWESIPSQS 33