BLASTX nr result
ID: Zingiber24_contig00034556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00034556 (437 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852139.1| hypothetical protein AMTR_s00049p00060930 [A... 58 1e-06 >ref|XP_006852139.1| hypothetical protein AMTR_s00049p00060930 [Amborella trichopoda] gi|548855743|gb|ERN13606.1| hypothetical protein AMTR_s00049p00060930 [Amborella trichopoda] Length = 333 Score = 57.8 bits (138), Expect = 1e-06 Identities = 32/56 (57%), Positives = 38/56 (67%) Frame = +2 Query: 98 PSQSEDAAMALRLQREEFMVAFQGNSTQGLRRQALYSAHANIRSMVSRGFYTRTRS 265 P+Q EDAA+ALRLQREEFM F + +Q RR L SA AN+R+M SR R RS Sbjct: 277 PNQDEDAALALRLQREEFMAGF--HDSQFPRRSTLSSARANLRAMASRAMRLRERS 330