BLASTX nr result
ID: Zingiber24_contig00034157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00034157 (299 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002465307.1| hypothetical protein SORBIDRAFT_01g036010 [S... 61 2e-07 ref|NP_001144574.1| uncharacterized protein LOC100277584 [Zea ma... 58 1e-06 gb|EMS54871.1| hypothetical protein TRIUR3_13401 [Triticum urartu] 55 1e-05 >ref|XP_002465307.1| hypothetical protein SORBIDRAFT_01g036010 [Sorghum bicolor] gi|241919161|gb|EER92305.1| hypothetical protein SORBIDRAFT_01g036010 [Sorghum bicolor] Length = 545 Score = 60.8 bits (146), Expect = 2e-07 Identities = 35/60 (58%), Positives = 40/60 (66%), Gaps = 2/60 (3%) Frame = +3 Query: 126 EAVTAGMAEIDTSAPFLSVREAVDRFGGIAIWKSQL-RELFHPEKLN-YPEDANEVISME 299 +A G AEIDTSAPF SVREAVDRFGG A W S L R +F P K + + E A E I+ E Sbjct: 16 DAAGGGRAEIDTSAPFESVREAVDRFGGSAAWSSDLVRRMFAPSKKHEHSEQAAEAINAE 75 >ref|NP_001144574.1| uncharacterized protein LOC100277584 [Zea mays] gi|194705104|gb|ACF86636.1| unknown [Zea mays] gi|195644052|gb|ACG41494.1| hypothetical protein [Zea mays] gi|413955797|gb|AFW88446.1| putative DUF827 domain containing family protein [Zea mays] Length = 545 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/55 (60%), Positives = 37/55 (67%), Gaps = 2/55 (3%) Frame = +3 Query: 141 GMAEIDTSAPFLSVREAVDRFGGIAIWKSQL-RELFHPEKLNYPED-ANEVISME 299 G EIDTSAPF SVREAVDRFGG A+W S L R +F P K + D A E I+ E Sbjct: 21 GRVEIDTSAPFESVREAVDRFGGSAVWSSDLVRRMFAPSKKHEQSDQAAEAINAE 75 >gb|EMS54871.1| hypothetical protein TRIUR3_13401 [Triticum urartu] Length = 604 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/47 (65%), Positives = 32/47 (68%), Gaps = 2/47 (4%) Frame = +3 Query: 129 AVTAGMAEIDTSAPFLSVREAVDRFGGIAIWKSQL--RELFHPEKLN 263 AV G AEIDTSAPF SVREAVDRFGG A W S L R H +K N Sbjct: 30 AVGGGRAEIDTSAPFESVREAVDRFGGSAAWSSHLVNRIFAHHKKQN 76