BLASTX nr result
ID: Zingiber24_contig00033847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00033847 (398 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828388.1| hypothetical protein AMTR_s00060p00016430 [A... 60 2e-07 >ref|XP_006828388.1| hypothetical protein AMTR_s00060p00016430 [Amborella trichopoda] gi|548833136|gb|ERM95804.1| hypothetical protein AMTR_s00060p00016430 [Amborella trichopoda] Length = 548 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -2 Query: 310 MGIEILALSLASPASQWERLSSSCQASTRGFIEMASLHLGASALS 176 MG+E+LALSL++PASQWER+SSS QASTRG +EM + L S S Sbjct: 1 MGVEVLALSLSAPASQWERVSSSFQASTRGLVEMGTSELKVSHFS 45