BLASTX nr result
ID: Zingiber24_contig00033622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00033622 (516 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA50331.1| TPA: hypothetical protein ZEAMMB73_935981 [Zea m... 56 4e-06 >tpg|DAA50331.1| TPA: hypothetical protein ZEAMMB73_935981 [Zea mays] Length = 602 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -3 Query: 97 CSCTKDDFFPEETFQSWESYMRSLRQTGPRL 5 CSCTK DFFPEE+F SW +Y R+LR TGPRL Sbjct: 21 CSCTKADFFPEESFSSWSAYGRALRSTGPRL 51