BLASTX nr result
ID: Zingiber24_contig00033465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00033465 (554 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADQ38903.1| phosphatidic acid phosphatase-like protein [Musa ... 59 8e-07 >gb|ADQ38903.1| phosphatidic acid phosphatase-like protein [Musa acuminata AAA Group] Length = 309 Score = 58.9 bits (141), Expect = 8e-07 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +2 Query: 341 EIPDRYGGSQPLLPLTAKEKD*KFRV-VSKLLNGNSVDATDW 463 E+PDR GSQPLLPL KEKD KFR KLLNGN+VDA DW Sbjct: 242 EMPDRSSGSQPLLPLNVKEKDGKFREDHRKLLNGNTVDAADW 283