BLASTX nr result
ID: Zingiber24_contig00033362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00033362 (464 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002441381.1| hypothetical protein SORBIDRAFT_09g025601 [S... 56 6e-06 >ref|XP_002441381.1| hypothetical protein SORBIDRAFT_09g025601 [Sorghum bicolor] gi|241946666|gb|EES19811.1| hypothetical protein SORBIDRAFT_09g025601 [Sorghum bicolor] Length = 140 Score = 55.8 bits (133), Expect = 6e-06 Identities = 34/90 (37%), Positives = 51/90 (56%), Gaps = 11/90 (12%) Frame = -1 Query: 425 SSFLGGCIDPHSFL---LRPDQSRFDLLTREEDLETRQ--RINWVSILIKRLMKKGRSIC 261 SS+ GC+ ++L +R +RF LL R +D R R W +L +RL+++ +SI Sbjct: 18 SSYFSGCMSSPAWLPPGVRRSPARFQLLARGDDAAGRGGGRRAWRGLL-RRLVRESKSIV 76 Query: 260 CSKPLR------LGYDEESYSKNFDDGQWN 189 CS R YD +SY+KNFDDG+W+ Sbjct: 77 CSNACRAPVAATFKYDADSYAKNFDDGRWH 106